KEGG   Gallus gallus (chicken): 427330Help
Entry
427330            CDS       T01006                                 

Gene name
SNX30
Definition
(RefSeq) sorting nexin-30
  KO
K17921  sorting nexin-7/30
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    427330 (SNX30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX Vps5 BAR BAR_3_WASP_bdg
Motif
Other DBs
NCBI-GeneID: 427330
NCBI-ProteinID: XP_424910
CGNC: 11678
Ensembl: ENSGALG00000015660
UniProt: F1ND98
Position
Z
AA seq 438 aa AA seqDB search
MSGGAAGIPKPLPSSGPKSLREMPHPLATSSSEEMGPALTPSPDLLLPRSIADKDLSLPN
GTPVDTSSPASSSSLLNRLQLDDDLDGETKDLFVTVDDPKKHVCTMETYITYRVTTKTTR
AEFDLPEYSVRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKA
LDKFLKRITDHPVLSFNEHFNVFLTAKDLNAYKKQGMALLSKMGESVKYVTGGYKLRSRP
LEFAAIGEYLDTFSLKLGTIDRIAQRIIKEQLEYLVELREYGPIYSTWGGLEVELSEPLE
GVSACIGNCCTALEELSEDMTDDFLPVLREYILYSESMKNVLKKRDQVQAEYEAKLEAVA
LKKEDRPKVPTDVEKCQDRVECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYEKC
LTAWESIIPLLQDKPETK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcggcgcggcgggcattcctaaacctctcccgtcctccgggcccaaatcgctg
cgggagatgccgcatcctctggccacctccagcagcgaggagatggggccggctctcacc
cccagccccgacctgctgctgccccgcagcatcgccgacaaggatctcagtctacccaat
ggcacaccagttgacacttctagcccagcctcctcctcatctcttctcaacagactgcag
ctggatgatgacttggatggggaaacaaaagacttgttcgttactgttgatgatcccaaa
aagcacgtatgcacaatggagacttacatcacgtatagggttacaacaaagactacccga
gctgaatttgatttgccagagtattctgttcgccggcggtaccaagactttgactggttg
agaaacaagctggaagagtctcagccaacacatctcattcccccgcttcctgagaaattt
gtggtgaagggtgttgttgatcgcttttctgaagagtttgtggagaccaggaggaaagca
ttagacaaattcttgaagagaataactgatcatccagtgctttctttcaatgagcatttc
aacgtatttctcacagccaaggatcttaatgcatacaaaaagcaaggaatggcattgctg
tcaaagatgggggagtcagttaaatatgtcacaggaggttacaaattaagaagtcgtcca
ctggagtttgcagccattggagagtatctggacacattctctctaaaacttggtaccatt
gacaggatagcacaacggattatcaaggaacagttggaatacttggtggaattacgagaa
tatggacctatttattcaacctggggcgggctggaggttgagctgtcagagcctctggaa
ggggtgtctgcatgcattggaaactgctgcacagctcttgaagaacttagtgaagatatg
acagatgacttcctgccggtgcttagggaatatatactgtattctgagtcaatgaagaat
gtgttgaagaagagagaccaagttcaagcagagtatgaagcaaaactggaagcagtagcc
ttgaaaaaagaagaccgtccaaaggtacctacagatgttgagaaatgtcaagaccgagta
gaatgttttaacgctgatctgaaagcagatatggagagatggcagaacaataagcgacaa
gactttaggcagctactcatgggaatggcagataaaaacatccagtactacgagaagtgc
cttacagcatgggagtcaattataccactattgcaagacaagccagagaccaaataa

DBGET integrated database retrieval system