KEGG   Gallus gallus (chicken): 427347
Entry
427347            CDS       T01006                                 

Gene name
CBWD1
Definition
(RefSeq) COBW domain-containing protein 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: cobW CobW_C GTP_EFTU RsgA_GTPase MMR_HSR1 AAA_16 AAA_23 AAA_22 PND Zeta_toxin ABC_tran TsaE Phenyl_P_gamma AAA_29 AAA_18
Other DBs
NCBI-GeneID: 427347
NCBI-ProteinID: NP_001026607
CGNC: 53055
Ensembl: ENSGALG00000010147
UniProt: Q5ZK54
Position
Z
AA seq 370 aa
MEDEDCPDLVPIDVGIVQDSEPGSGRKIPVTIITGYLGAGKTTLLNYILTEQHSKRIAVI
LNEFGEGSALEKSLAISQGGELYEEWLELRNGCLCCSVKDNGVKAIENLMQKRGKFDYIL
LETTGLADPGAVASMFWVDSELGSDIYLDGIVSVVDAKHGLQHLTEEKPEGLVNEAARQV
ALADLIIINKTDLVSGEELNKVRASVRSINGLVKILETQRSRVDLSNVLDLHAFDSLSGI
SLQKKLENMKTAHAHLDKGIVTVTFEVLGNIKEENLNLFIQNLLWEKNVKDKTGRTMDVI
RLKGLVSIQGKSHQVIVQGVHELYDLEETAVAWKEDEKRTNRLVLIGRNLNKEIIKEVFI
ETVSEKHESS
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggaggatgaagactgccccgatctggtgccgatagacgtcggtatcgtgcaggacagc
gagcctggctccggcaggaagatccccgtgaccatcatcacgggttacctaggtgctggg
aaaacaacgcttctgaattacattctgactgaacaacatagcaagagaatcgcagtgata
ctgaatgagtttggagaagggagtgcactggagaaatctttggcaatcagtcagggagga
gaactctatgaagaatggctggagctaagaaatggctgtttgtgctgctcagtaaaggac
aatggtgtgaaggctattgagaacctcatgcaaaagagaggaaaatttgactatatattg
ttggaaacaactggtttggcagatccaggagctgtggcctccatgttctgggttgattct
gagctgggaagcgacatctatcttgatggcattgtatctgttgttgatgcaaagcatgga
ttgcagcacttgacagaggagaaaccggaaggccttgtcaatgaagcggcaaggcaggtt
gcattagctgatcttataatcatcaataaaacggatttggtttcaggggaagaactgaat
aaagtcagagcgtctgtcaggtcaataaatggactcgtcaaaattttggagacacaaagg
tcaagagttgatctttccaatgtactggacctgcatgcttttgacagtctatctggaata
agcttgcagaaaaaacttgagaatatgaagacagcacatgcacatctagataagggtata
gtgacggtaacatttgaagtcctaggaaacatcaaggaagaaaaccttaatctctttata
cagaatcttctgtgggaaaagaatgtgaaagataagactggacgtaccatggatgtcata
agactgaagggactcgtatctattcaaggcaaatctcatcaagtgatagtccaaggtgtc
catgagctctacgacctggaagagactgcagtagcatggaaggaagatgaaaaaagaaca
aatagacttgttttaattggtaggaacttgaataaggaaatcatcaaagaagtattcata
gaaactgtgtcagagaagcatgaaagcagttga

DBGET integrated database retrieval system