KEGG   Gallus gallus (chicken): 427348Help
Entry
427348            CDS       T01006                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X2
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    427348 (DOCK8)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    427348 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GPR15L
Motif
Other DBs
NCBI-GeneID: 427348
NCBI-ProteinID: XP_015135633
CGNC: 7720
Position
Z
AA seq 2083 aa AA seqDB search
MATLPAADRRAFALKINRYSSAEVRKQFTLQPGFAQFCQRSLSTPGFSPLHLPSFYDAVD
PVDFEGFLMTQLNNLDSEMAHELGDFPEDDLDIVFTPKECRTLQPSMPEDGVELDSHVRD
CVQTYIRDWLIVNRKNQGNSDICSLKNKGSRKDFHKHLQKQTFESETSDSSDASFQAGPR
PVHVLPEDTSRTAPASSDFDLRSLQPDPRLENLLRHVSAEEFERQNEEARRTNRHAELLA
LYPSVDEEDAVEIRPVPDRPKEHLGNRILVKLQTLKFDIEIEPLFACIALYDIKERKKIS
ENFHCDLNPDSLRGFLRSHTPSTDLSTQARSAVFSVTYPSSDIYLVIKIEKVLQQGEIGD
CAEPYMVLKENEAGKTKEKIEKLKAQAECFCQRLGKYRMPFAWIPISLTNFFNVSTLERE
VSEAEGLNGKGSTSDKRATLLQARRLSERSLSTEDSYPVSNFKTVSLTHSTFFKQEGDRL
SDEDLFKFLADFKRSSSLQRRIKTLPGTLKLEISPAPENLGYCLTPELLPVKPFPENRSR
PHKEILEFPIKEVYVPHTIYRNLLYVYPQRLNFANRPASARNITIKIQFMCGEDPSCAMP
VIFGKSSGPEFVQEMYTAITYHNKSPDFYEEVKIKLPAKLTEKHHLLFTFYHISCQPKQG
ASVETLIGYSWLPILLNDRLQTGHYCLPVALDKLPFHYSIHSPEKVPSQTPPIKWVEGHK
GVFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVTFPIRLMDQKITEATLEHELKLSIIC
LNSSRLEPLVLFLHLVLDKLFQLAVQPMVIAGQTANFSQFAFESVVAIVNSLHNSKYLSK
DQHGRNCLLASYVYYVFRLPDPQKEVPKLVSVGSKLLQSRVISCSNPDITVTQTAADEEV
KNIMSSKPADHSSSRMSFYIEGTNDMPGVCTNPRPSSKKHFHEELALQMVVSTGMVREAV
FKYAWFFFELLIKSMAQYVHSIEKQDNVRRSRFSDRFKDDVTTIVNVVTSEIAALLVKPQ
KESEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSNKLNSLSTLISMRLEFLRI
LCSHEHYLNLNLFFMTSASTPASPSPSLSSQNSSSCSSFQDQKIAGMFDLSSEYRQQHFL
TGLLFTELAAALDADCEGISKVQRKAVSAILSLLSSHDLDPRCSRKEMKIKIAALYLPLV
GIILDSLPQLHDFTISDARSGKGRTGNPEEEQESAGAISQNVALAIAGNQFNLRSSGTSL
ASLSYRQSATLGPDTTRNLLICFLWIMKNADQNLIQKWIADLPSMQLNRILDLLFICVSC
FEYKGKQSSDKVSNQALQKSRDVKAKLEEALLRGEGARGEMMKRCRIPAGNDRSAGLNEN
LRWRKEQTEWRQANERQDKTKAELDQEALISGNLATEANLIILDMQENIIQASFAAECRD
NLLGGVLKVLVNSLGCDQSTTYLTHCFATLRALIAKFGDFLFEEEVEQCADLCQRVLHHC
SSSIDITRTQACATLYLLMRYSFSSTSNFARVKMQVTMSLASLVGKSPEFNEEFLRRSLR
TILAYAEEDVDMQATPFPIQVEELLCNLNSILSDTVKMREFQEDPEMLMDLMYRIAKGYQ
TSPDLRLTWLQNMAEKHTKRKCYTEAAMCLVHAAALVAEYLSMLEDRSYLPVGSVSFQNI
SSNVLEESAVSDDVLSPDEDGICSGRYFSESGLVGLLEQAAELFNTGGLYETVNEVYKIV
IPILEAHRDFRKLTLTHSKLQKAFDSIINKGQKRMFGTYFRVGFYGSKFGDLDEQEFVYK
EPAITKLPEISHRLEGFYGQCFGEDNVEVIKDSAPVDKSKLDPNKAYIQITFVEPYFDEY
EMKDRVTYFEKNFNLSRFMYTTPFTMDGRPRGELSEQYKRNTILTTMHAFPYIKTRINII
QKEEFILTPIEVAIEDMRKKTQELTAATNQEPPDAKMLQMVLQGSVGATVNQGPLEVAQV
FLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVNKNKHLITADQREYQQELRKNYGKLKE
NLRPMIERKIPELYKPVVKVNSSRESFRNHSFRKYDAQTSQST
NT seq 6252 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgttacccgccgctgaccggagggcgttcgccctaaaaatcaacaggtactcc
tctgcagaagtaagaaagcaatttacccttcaaccaggctttgcacagttctgtcagcgt
agcttaagtactcctggcttttctcctcttcatctgccttccttttatgatgcagtagac
ccagtagatttcgaaggcttcctaatgacacagctgaacaacttggactcagaaatggca
catgaacttggtgattttcctgaggatgacttggacattgtctttacacccaaagaatgc
aggactctgcagccttctatgccagaagatggggttgagctggattcgcatgtgagagac
tgtgttcagacctatatccgggactggctgatcgtgaatagaaagaaccaagggaactca
gatatttgcagcttgaaaaacaagggatcccgaaaagattttcacaagcatcttcagaaa
caaacatttgaatcagaaacttcagactctagtgatgcaagctttcaggcagggcccagg
cctgtgcacgtgctccctgaggacacctccaggactgccccggcctcctctgactttgac
ctgcgcagcctgcagccggatccccgcctggaaaacctgctgcggcatgtcagtgcagag
gagtttgagaggcagaatgaggaagcccgacgaaccaacagacacgctgagctccttgcc
ctctacccgtctgtggatgaggaagatgcagtggaaatacgaccggtgccagatcgccca
aaggaacacttgggcaacaggattctggtaaagctgcagactctgaagtttgatatagag
attgagcctttgtttgcatgcatagctctctatgatataaaagaaagaaaaaagatctct
gaaaatttccattgtgacctgaaccctgattcattaagaggattcttgcgttctcataca
ccctccactgacttgtctactcaggcaagatcggcagtattttctgtcacttatccctcg
tcggatatatacctagtaataaagatagaaaaagtgcttcagcaaggagaaattggagat
tgtgcggagccctacatggttcttaaagaaaatgaagctggcaagacaaaagaaaagatt
gaaaaactgaaagcccaagctgagtgcttttgtcagcgactagggaaatacagaatgcca
ttcgcctggattcccataagtctaactaatttcttcaacgtttccacgcttgaacgagaa
gtatctgaggctgaaggtttgaacgggaaaggatcaactagtgataaaagggcaacacta
ttacaagcaagaagactttctgagagaagtctcagcactgaggacagttatccagtatca
aactttaaaactgtctccctgacccacagcaccttctttaaacaggaaggagacaggctt
agtgatgaagatctgttcaaatttttagctgacttcaaaagatcatcttccttgcagaga
agaattaagactttaccaggaacacttaaactggagatctctccagctccagaaaacctt
ggttattgtctgacaccagaattactaccagtgaagcccttcccagaaaatcgtagtcgt
cctcacaaagagattttggaattcccaattaaagaagtgtatgttccccatactatttat
agaaatctcctctatgtttacccccagaggctgaattttgctaaccgaccagcttctgca
agaaacattaccatcaagatccagtttatgtgtggtgaagacccgtcctgtgcaatgccg
gtaatttttggaaaatcttcaggtccagaatttgtgcaagagatgtatacagctatcaca
tatcataacaagtctcctgacttttatgaagaagtgaaaattaaactgccagcaaaactc
acagagaaacaccatctattgtttacattctatcatatcagctgtcagccaaagcaagga
gcatctgtggaaactctcattgggtattcatggctgccaattctgttaaatgatcgtctt
caaacaggacattattgtcttcctgttgcattggataagctgccattccactattcaatt
cactctcctgagaaagttccgtcacagacaccacctatcaaatgggttgaaggacacaaa
ggtgttttcaatattgaagtgcaagctgtttcatctgttcacacccaggacaatcacttg
gagaagttcttcactctgtgccattctctggaaagtcaagtgaccttccccattcgacta
atggaccagaagatcactgaggctacactggaacacgaactgaaactcagcattatctgt
ttgaattcttcacgacttgaacctcttgttttatttttacatctggtactagataaactt
ttccagctggctgtacagcctatggtcatagctggccagacagccaacttctcacagttc
gcttttgaatctgtggttgcaatagtgaacagtctccacaacagcaaatacctgagcaaa
gatcagcacgggaggaactgcctcctggcatcgtatgtctactacgtatttcgcctgcca
gaccctcaaaaagaagtgccaaaactagtgtccgtcgggagtaaactcctgcagagccga
gtgataagctgcagcaaccctgacatcacggttacacagacagctgctgatgaagaggtc
aaaaacatcatgtcgtccaagcctgcggatcacagctccagccggatgtcattttacatt
gaaggaacaaatgacatgccaggtgtttgtacaaacccaagaccatccagtaaaaagcat
ttccacgaggagctggcactgcagatggtggtcagcacgggtatggtgagagaagctgtc
ttcaagtatgcctggttcttctttgagctcctgataaagagcatggctcagtacgttcac
agtatagagaagcaagacaatgtacgaagaagccgattctctgaccgtttcaaagacgat
gttaccactatagttaacgtggttacttctgagattgctgcacttctagtcaagccccag
aaggaaagtgaacaagcagaaaaaattaacatcagcctggcatttttcctgtatgatctt
ctttctttaatggaccgaggatttgtgtttaatctcatcaaacattactgtaatcagctc
tcaaacaagctgaattctctttccaccctgatttccatgagactggagttcctgagaatt
ctctgcagccatgagcactacctgaatctgaacctcttcttcatgacctcggcctctact
ccagcgtccccctcaccctctttgtcctcacagaactctagctcctgctccagcttccag
gaccagaaaattgctggtatgtttgacctctcatcagaataccgtcagcagcactttctg
actgggttgctcttcacagaattggcagcagccctggatgcggactgtgaggggattagt
aaggtgcaaagaaaagcagtcagtgctatccttagcctgctgagttcccatgacctagac
ccacgttgttccagaaaagagatgaagattaaaattgctgctctctacctccctttggtt
ggtataattttggattcactgccacagctgcatgactttacaatttcagatgcccgcagc
ggaaaggggcgcacaggaaacccagaagaagaacaggagtccgcaggtgcaatcagtcaa
aatgtggcacttgctattgcggggaatcagttcaacctcaggagctctggaacatctttg
gcgtccttgtcctacagacagagtgccacattaggtcctgatactactcgcaatcttctg
atctgtttcctctggatcatgaaaaatgctgatcagaatctaatacagaaatggattgca
gaccttccatccatgcagctgaacaggatcttagacctcctttttatttgtgtttcgtgt
tttgaatacaagggcaaacaaagctcagataaagttagcaaccaagcactccagaagtcc
agagatgttaaggccaaactagaagaggctttgctgagaggcgaaggagccagaggagaa
atgatgaagcgctgcagaataccagctgggaatgacaggtcagcagggctaaatgaaaac
ctgaggtggagaaaggagcagactgaatggcggcaggcaaatgagagacaagataagaca
aaagcagagctagaccaagaagctctcatcagtggaaacctggcaactgaagctaacctg
atcatccttgacatgcaagagaacatcatccaggcaagctttgcagcagagtgcagagac
aatcttttgggaggagttttgaaggtcctggtaaattctcttggctgtgaccagagcacc
acttacctgactcactgctttgctacactcagagcactcattgctaagtttggagatttc
ctgtttgaagaggaggtggaacagtgtgctgacctctgtcaaagagttctccatcactgc
agcagcagcatagatataacacggactcaagcctgtgctactctttatcttctcatgaga
tacagcttcagctctaccagtaattttgcaagagtgaagatgcaggtgaccatgtcacta
gcttccttggttggcaaatcacctgagtttaacgaggaattccttcgacgatctttacga
actatcctggcctatgcagaggaagatgtggacatgcaagcaactccgtttcccattcag
gtagaggagctgctgtgtaatctgaacagcatcctgtcagacacagtgaaaatgagggaa
tttcaggaagatccggaaatgctcatggatcttatgtacagaattgccaaagggtaccag
acatcacccgacctgagactgacttggctgcagaacatggcagagaagcacaccaaaagg
aagtgctacacagaagcagctatgtgcctcgtccatgctgctgcgctggtggcagaatac
ctcagcatgcttgaagatcgcagctatctcccagtgggtagcgtcagctttcagaacatt
tcatccaatgtgctggaggaatccgctgtttcagatgatgttttgtctccggatgaagat
ggtatatgttctgggaggtacttctcagaaagtggcctggtggggttactagaacaagca
gcagaactcttcaacacgggagggttgtatgaaactgtgaatgaagtgtacaaaattgtc
atccccatactggaagcacatcgagacttcaggaagcttaccttgacacacagcaagcta
cagaaggcctttgacagcattattaataagggccagaagcgaatgtttggaacttacttc
cgtgttggtttctatggatccaaatttggtgacttagatgaacaggaatttgtttacaag
gagcctgcaattaccaaacttcctgaaatttctcacagattagagggattttatggtcag
tgctttggggaagataatgtggaagtgattaaagactctgctcctgtcgacaaaagcaag
ctggatcccaataaggcatacatacagattacttttgtggagccatattttgatgaatat
gagatgaaagacagggtaacttactttgaaaagaacttcaacctcagtcggttcatgtac
actacgcctttcaccatggatgggcgccctagaggagaacttagtgagcagtacaagagg
aacaccattttgaccacaatgcatgctttcccctacatcaaaaccagaataaacatcatc
caaaaagaagagtttattttaacaccaattgaagttgctattgaagatatgcggaaaaaa
acacaagaactaactgcagctacgaaccaagagccaccagatgctaaaatgctacagatg
gttttgcagggctcagtgggagccactgtaaatcagggaccactagaggtagcgcaagtg
ttcctggctgaaattccagcagaccccaaactttatcgacatcacaacaaactgaggttg
tgcttcaaagagtttataatgaggtgcggtgaagcagtgaataaaaacaagcaccttatt
actgctgaccagcgggaatatcagcaagaactcagaaagaactatgggaagctgaaggag
aaccttaggcccatgattgagagaaagatcccagagctgtacaaacctgtagttaaagtc
aacagctcaagggaatcatttcgtaaccacagtttcaggaagtacgatgcccagacttca
cagagcacctaa

DBGET integrated database retrieval system