KEGG   Gallus gallus (chicken): 427424Help
Entry
427424            CDS       T01006                                 

Gene name
ZFR
Definition
(RefSeq) zinc finger RNA-binding protein isoform X1
  KO
K13203  zinc finger RNA-binding protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    427424 (ZFR)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    427424 (ZFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DZF zf-met zf-C2H2_jaz zf-U1
Motif
Other DBs
NCBI-GeneID: 427424
NCBI-ProteinID: XP_004937226
CGNC: 53082
Position
Z
AA seq 1071 aa AA seqDB search
MIPICPVVSFTYVPSRLGEDAKMATGNYFGFTHSGAAAQYSQQPASGVAYSHPTTVASYT
VHQAPVAAHTVTAAYAPAAATVAVARPAPVAVAAAATAAAYGGYPTAHTATDYGYTQRQQ
EAPPPPPPVTTQNYQDSYSYVRSTAPAVAYDSKQYYQQPTATAAAVAAAAQPQPSVAESY
YQTAPKAGYSQGATQYTQAQQTRQVTAIKPATPSPATTTFSIYPVSSTVQPVAAAATVVP
SYTQSATYSTTAVTYSGTSYSGYEAAVYSAASSYYQQQQQQQKQAAAAAAAAAATAAWTG
TTFTKKAPFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKAS
QNTNNSSTSARGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEP
NVVTQASSSTSTSASKPAASASSIATSSSTVNSSVASSAVKILTPTANTPLNTASNNKTS
STAANIAVKKISTPKINFVGKYRSGNKLQTTGSKLEEMKSTESVKTTPTATVQTQEVKPD
TAAEPVTPTTLAALQSDVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKG
RRHRLQYKKKVNPDLQVEVKPSIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYE
EDMYWRRMEEEQHHWDDRRRIPDGGYPHGPPGPLGLLGVRPGMPPQPQGPAPLRRPDSSD
DRYVMTKHAAIYPTEEELQAVQKIVSITERALKLVSDNMTDNEKNKSKEGDDKKDGSKDR
ALKGVLRVGVLAKGLLLRGDRNVNLVLLCAEKPSKTLLCRIAESLPKQLAVISPEKYDIK
CAVPEAAIILNSCVEPKMQVTITLTSPVIREENMREGDVTSGMVKDPPDVLDRQKCLDAL
AALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSATGPQS
PGDALRRVFECISSGIILKGGPGLLDPCEKDPFDTLAVMTDQQREDITSSAQFALRLLAF
RQIHKVLGMDPLPQMNQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDNF
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgattcccatatgcccggttgtttctttcacctatgtgcccagccggctgggagaagat
gccaaaatggccaccggcaactactttggattcacccatagcggtgctgctgctcagtat
agccagcagccagcttcgggtgtagcatattcccatccaactacagtggctagctacact
gtccaccaggcaccagttgctgcgcacacagttactgcagcctacgctccagcagcagct
acagttgcagtagccaggcctgctccagtggctgttgcagctgctgcaacagctgctgca
tatggaggctatcctacagcgcacacagctacagattatggttatacacagaggcaacaa
gaagctccgccaccaccacctcctgtcactacgcagaattaccaggattcctattcttat
gttcgatctactgccccagccgtagcttatgacagcaaacaatattaccagcagccaaca
gcaactgctgcagctgtggccgctgctgcccagcctcaaccttcagtggcagagtcgtat
taccagacagctccaaaagcaggatatagccaaggggcaactcaatatactcaagcccag
caaacgcgacaagtaacagctataaaacctgcaaccccaagtccagcaacaactacgttt
tctatatatccagtatcctctactgtgcagcctgtagcagctgcagctactgttgttcca
tcctatactcaaagtgcaacatacagtacaacagcggttacttactccggtacctcttat
tctggctatgaggctgcagtgtattcagctgcgtcgtcctattatcagcagcagcagcag
caacagaaacaggcagcggcagctgctgctgctgctgcagcgacagctgcttggacaggg
accaccttcactaaaaaggcaccattccaaaataagcaactgaaaccaaaacaacctccc
aaaccaccccagatccactactgtgatgtttgtaagatcagctgtgctggaccacagact
tacaaagaacacttagaaggtcagaaacacaagaagaaagaagcagcgttaaaagcatcc
cagaacaccaataatagcagcacttctgctcgtggaactcagaatcagttgcgctgtgag
ctttgtgatgtgtcttgtacaggagcagatgcatatgctgcccatatccgtggagccaag
catcagaaagtagtaaaattgcacacaaaacttggcaaacccattccttcaactgaacca
aatgtggttacccaggcttcttcctcaacatccacatctgcttccaaaccagctgcctct
gcttcaagcatagcaactagcagcagtactgtgaactcctctgttgcgtcctctgcggtg
aaaattcttactcccacggcaaacacaccacttaacacagcgtccaacaacaaaacatct
tcaactgctgctaatatagcagtaaagaaaatatctacaccgaaaataaactttgttggc
aagtacagaagtggcaataagcttcagacaacaggaagtaaactggaagaaatgaaatca
actgaaagtgttaaaacaactcctactgccacggtacaaacacaggaagtgaaaccagac
actgcagctgaaccagtgactcctacaactcttgctgccttgcaaagtgatgtccagcca
gtgggacatgactatgtggaggaggtaagaaatgatgaaggaaaggtgatccgctttcac
tgcaaactttgtgaatgcagttttaatgaccctaatgccaaggagatgcacttaaaagga
aggcggcacagactccaatataagaaaaaagtaaacccagatcttcaagtagaagtgaag
cccagcattcgagcaagaaaaattcaagaagaaaagatgaggaagcagatgcagaaagaa
gaatactggagaaggcgggaagaggaggaacgctggaggatggaaatgaggcgatatgaa
gaggacatgtactggaggagaatggaggaagagcagcatcattgggatgaccgtcgtaga
ataccagatgggggatatcctcatggtcctccaggacctcttggcctgctgggagttaga
ccaggaatgcctcctcagccccaaggaccagctcctctgcgtcgccctgactcctcagat
gaccgctatgtgatgaccaaacatgcagcaatatatccaacagaggaggaacttcaggca
gtccaaaaaatcgtttctattactgagcgtgctttgaaacttgtttctgacaacatgact
gacaatgaaaaaaacaagagcaaagagggagatgacaaaaaagatggcagtaaagacaga
gctttgaaaggagttctgcgggtaggcgttttggctaaaggcttgctgctccgtggagac
agaaacgtcaatcttgttttgttatgtgctgagaagccttcaaagacattactctgtcgt
attgctgaaagtcttcccaaacaacttgcagtaataagtcctgagaaatacgatatcaag
tgtgcagtcccagaagcagcaataattttaaattcatgtgtggaacccaaaatgcaagtt
actatcacactgacatctccagtcattcgggaggagaacatgagggaaggagatgtaacc
tcgggtatggtgaaagacccaccggacgtcttggacaggcaaaaatgccttgacgctctg
gctgctctacgccacgctaagtggttccaggctagagctaatggtctgcagtcctgtgtg
attatcattcgtattcttcgtgacctctgtcagcgtgttccaacttggtctgattttcca
agctgggccatggagttgctcgtggaaaaagcaatcagcagtgctactggaccacagagc
cctggggatgcacttaggagagtttttgagtgtatatcttcaggaatcatccttaaaggt
ggtcctggccttctggacccttgtgaaaaagatccttttgatacacttgctgtaatgaca
gatcagcaacgagaggatattacttcaagtgcacagtttgcactgagactccttgcattc
cgtcaaattcacaaagttttaggaatggatccactaccacagatgaatcaacgcttcaac
atccataacaatcgtaagaggagaagggacagtgatggggttgatggatttgaagcagaa
ggaaaaaaagacaaaaaggattatgataacttttaa

DBGET integrated database retrieval system