KEGG   Gallus gallus (chicken): 427449
Entry
427449            CDS       T01006                                 

Gene name
DAB2
Definition
(RefSeq) disabled homolog 2 isoform X1
  KO
K12475  disabled homolog 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    427449 (DAB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    427449 (DAB2)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    427449 (DAB2)
SSDB
Motif
Pfam: PID
Other DBs
NCBI-GeneID: 427449
NCBI-ProteinID: XP_015133023
CGNC: 53091
Ensembl: ENSGALG00000003803
UniProt: A0A3Q2ULI9
Position
Z
AA seq 715 aa
MSTEAETTSTVNSQPEHQAPPKAQTSKKEKKKGPEKTDESLLARFKGDGVRYKAKLIGID
DVPEARGDKMSQDSMMKLKGMAVAARSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPV
TKISFIARDVTDNRAFGYICGGEGQHQFFAIKTAQQAEPLVVDLKDLFQLIYNMKKKEEE
EDKKKSEEANKTQNGSEALPAGQADKLKLGVDQMDLFGDMSTPPDLSSPSEAKEILLVDL
NSEIETKQTFTKEDLFLNGITPSLPQPKPRPPFLPESSFSTNLNFFPTPNPDPFSDDPFA
QPDQSAPPSFDSLKSADQKKENLSTLTSVGNGASNGDVDYFGKQFDQISNRVGKREALTS
QWPFDSKPPTARTPNGVPEREQNGFLKVPSNLFVEDPSKGVILQNGVKLDSESNIQLLSH
ESITISPPPQSNKPGRGRRSVKTASNDLFSSDFFAPTTENIGLNSSVQTGLAQTNRLDLF
KTNPTTAPPLAGLGGMPSPWSTEIPAFTQATSVFPGSMMRTQSPGFTQQLTFGTQAVPSW
SQPGSFGPTVSQSSGLWAQPAQVPPAPWVQPSSAVNPFQSSVFAPSTLPAQTQSVLPPVS
TTSPPQPPPRTAPQKELSKKESDAFIALDPLGDREMKDVKEMFKDFQLTKPPAVPARRGE
QQSLSEPLKPVPRQSALPIDGLFESQPKPDLFSVSSESQKQPSCPFGGHSGNPFV
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgtctacggaagctgaaactacttctactgtcaacagccagccagagcaccaggctcca
cctaaagcacaaacttcaaagaaagaaaaaaagaaagggccagaaaagacagatgaatct
ctcctggccagattcaaaggggatggtgtaagatacaaagctaaattgattggcattgat
gatgtgccagaagcaagaggagacaaaatgagtcaggattcaatgatgaagttgaaggga
atggcagtggcagctcgttcccagggtcaacataagcagaggatctgggtgaacatctcc
ctctctggtatcaagatcatagatgagaaaactggggtcatagagcatgagcacccagta
accaaaatctctttcattgctcgggatgtaacagataatcgtgcttttggctatatttgt
ggaggagaaggccagcaccagttttttgccataaaaacagcacagcaggctgagcctcta
gttgttgatcttaaggacctcttccaactgatatataacatgaagaagaaggaagaagaa
gaagacaagaaaaagagtgaagaagcaaataagactcagaatggtagtgaggccctacct
gctggtcaagctgacaaactgaaactgggagttgaccagatggacttgtttggggatatg
tcaacacctcctgatctgagcagtccctcagaagctaaagagattctcttagtggatcta
aactcagaaattgagaccaaacagacttttacaaaagaggatctcttcttgaatggcatc
acaccttctcttccacaaccaaagccacgaccacccttcttgccagagagttctttctct
accaatctcaacttctttcccacacctaatccagaccctttcagtgatgatccttttgca
cagccagaccaatccgcaccaccttcatttgattctctaaaatctgctgatcagaagaag
gaaaatctgagtaccttgacatcggtgggtaatggtgcttcaaatggtgatgttgactac
tttggtaaacagtttgaccagatatctaatagagttggcaaacgagaagcactaacaagc
cagtggccatttgacagtaagccacccacagcaagaactccaaatggggtaccagagaga
gaacagaatggctttcttaaagtcccatcaaacctctttgtggaagatccttccaaagga
gtaattctgcaaaatggagtaaagctggattctgaaagcaatatccagctcttgtcacat
gaatctataacaattagcccaccaccacagagtaacaagccaggaagaggaaggaggtct
gtcaagactgcatcaaatgacttgtttagctcggacttttttgcaccaactacagagaac
attggcttaaactcatcagtacagacaggactggcgcaaactaatcgactggacctcttc
aaaaccaatcctaccacagcccctccattggctggcctaggtggtatgccatcaccatgg
agtacagagatacctgccttcacccaggccacatctgtctttcctgggtctatgatgcgt
acccagtctccaggatttactcaacaacttacctttggcactcaagcagtgccaagctgg
agccagcctggatcttttggtccaacagtatctcagtcctctggtctctgggcacagcca
gcacaagttccacctgctccatgggtacagccatccagtgctgtaaatcccttccagagt
agtgtgtttgcaccttcaacgctacctgctcaaacacagtctgtactgccccctgtgtca
acaacaagcccacctcagccaccacccagaactgcacctcaaaaggagctttccaagaaa
gagagtgatgcttttattgctctggatccgcttggtgatagagagatgaaggatgttaag
gaaatgttcaaagatttccagctgacaaagccacctgcagtaccagcaaggagaggagag
cagcaaagtctttcagaaccactgaagcctgttcccagacaaagtgcactaccaattgac
ggcctgtttgaaagtcaacctaaaccagaccttttcagtgtctcctctgaatctcagaaa
caaccttcttgcccatttggtggtcattctggcaacccttttgtgtag

DBGET integrated database retrieval system