KEGG   Gallus gallus (chicken): 427458
Entry
427458            CDS       T01006                                 

Gene name
HNRNPK
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein K isoform X3
  KO
K12886  heterogeneous nuclear ribonucleoprotein K
Organism
gga  Gallus gallus (chicken)
Pathway
gga03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    427458 (HNRNPK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    427458 (HNRNPK)
Spliceosome [BR:gga03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    427458 (HNRNPK)
SSDB
Motif
Pfam: KH_1 ROKNT KH_2 KH_4 KH_5 MOEP19 DJ-1_PfpI
Other DBs
NCBI-GeneID: 427458
NCBI-ProteinID: XP_003643054
CGNC: 53093
Ensembl: ENSGALG00000012591
UniProt: E1C453
Position
Z
AA seq 427 aa
METEQQEETFTNTETNGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGK
NIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQHYKGSDFDCEL
RLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIK
IILDLISESPIKGRAQPYDPNFYDETYDYGGFTMFDDRRGRPVGFPMRGRGGFDRMPPGR
GGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMSYDRRGR
PGDRYDGMMMQCHVDACDDMQPPELFEGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKD
LAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ
YADVEGF
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggagactgaacaacaggaggagaccttcaccaacacagagacaaatggcaaacgtcct
gcagaagatatggaggaagaacaggccttcaagagatctcggaatacagatgagatggtt
gaactacgtatcctgcttcaaagcaaaaacgctggagcagtgattggaaaaggtggcaaa
aacattaaggcacttcgtacagactacaatgccagtgtttcagtcccagacagcagtggc
cccgagcgcatcttgagtataagtgcagatatagagacaattggagaaatcttgaagaag
attatccctactttagaagagtatcaacactacaaaggcagcgactttgactgcgagtta
agacttcttattcaccagagtttggcaggaggaattattggtgtcaagggtgctaaaatc
aaagaactcagagagaacactcagaccaccattaagctcttccaagaatgttgtcctcat
tcaactgacagagtggtgcttattggtggaaaacctgatagagttgttgaatgtatcaag
attattttggatcttatctctgagtctccaataaaaggacgggcccagccttatgatccc
aacttctatgatgaaacatatgactacggtggcttcactatgtttgatgacagaagggga
cgtccagtaggctttcctatgcgtgggagaggaggttttgatcgaatgccacctggccgt
ggtggacgacctatgcctccatcaagaagagattatgatgatatgagccctcgtagagga
cctccaccacctccaccaggtcgtggtggcagaggcggcagcagagctcgtaatcttcct
cttcctcctccaccacctcctcgtggcggagatctgatgtcttatgacagaagaggcaga
ccaggagaccgttacgatggaatgatgatgcagtgtcatgtggatgcctgtgatgacatg
cagccaccagagctgtttgagggtggctctggatatgactattcttatgcagggggtcgt
ggttcatatggagatcttggaggacctatcatcacaacacaagtaacaattcccaaagat
ctggcaggatctattattggaaagggaggccagagaatcaaacaaataagacatgagtct
ggagcttcaatcaaaattgatgaaccactagaaggctcagaagatcggattatcactatt
acgggaacacaggaccagatacaaaatgcacaatatttactgcagaacagtgtgaagcag
tatgcagatgttgaaggattctaa

DBGET integrated database retrieval system