KEGG   Gallus gallus (chicken): 427468
Entry
427468            CDS       T01006                                 

Gene name
FANCC
Definition
(RefSeq) Fanconi anemia group C protein
  KO
K10890  fanconi anemia group C protein
Organism
gga  Gallus gallus (chicken)
Pathway
gga03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    427468 (FANCC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gga03400]
    427468 (FANCC)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     427468 (FANCC)
SSDB
Motif
Pfam: Fanconi_C EF-hand_2
Other DBs
NCBI-GeneID: 427468
NCBI-ProteinID: NP_001006587
CGNC: 9576
Ensembl: ENSGALG00000012618
UniProt: Q5F3H0
Position
Z
AA seq 559 aa
MAQDTTVPKLNFKFWLDKAIEWGQDTTLESQKDVCLHLPQLQEFLHQTYETLKHMNSIAA
IQQFPLIGQLLGRLCWNPFVVGYDESQKTLMWCLCCLYSSEPQNPVELKANSWIRSLLCH
LLSSSKWERIEAETSTFISALGYTSADYYCHLVENIVSSLVTELRENQFNELNIQERISV
SRVNAVSLFCLPLITLPDLTPLLETLLLYHGGASKEILSSEFLEAVNDAVLKKKISLSES
AIFSLWHRHLPSLESATLSLLDQLTSLQINSLEKVACVIKDSLLPQAASHPAIFRIVNEI
FKNALLETDGAPEVMTIIQVFIQLFIQVQQNENKQHKFPLKAYFPHHHQPLVIALLRRPF
ELPSTHWLQHLKHISDTLKSIVEDTNVSSFADLYEIWFLVACFGEWLDIAAEQLMKAAVA
PDALLWLLAFYYCPQNENQQRTQTMVESQAVYSRLMMLYNRTVLSFGDLQASVNNAADTE
QCHTQCLITHLLTNFLLFSSGGHMIAQEFISHITETTDMSKEVCSLLIRTAYRIKHNGGE
NQRTVKLLNELLQKLAVEV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggcccaggatactacagtgcctaaattgaacttcaaattttggttggataaagctatt
gagtggggtcaggacaccactttggaatcccagaaggatgtctgtcttcacttgccccag
ctgcaagagtttctacatcagacttatgaaactctcaaacatatgaattcaattgcagca
attcagcagttccctttaattggccagttactaggaaggctttgttggaatccctttgtt
gtaggatatgatgaaagccagaagactctgatgtggtgcttgtgttgtctgtacagcagt
gaaccacagaaccctgtggaattgaaggccaacagctggatacgaagcttactgtgccat
ctcctttcttcttctaaatgggaaagaatcgaggctgaaaccagtacattcatatcagct
cttggctacacatcagcagattattattgtcacttggttgaaaatatagtctcctcatta
gtaactgaactcagagaaaatcaatttaatgaacttaacattcaggagagaatttcagtc
agtcgtgtgaatgctgtgtcccttttctgtctcccacttattactttgcctgatctaact
ccattgctggaaactcttcttctttaccatggtggagcttcgaaagaaattctcagctca
gagttcttggaggctgtgaatgatgccgttttaaagaagaagatctccctttctgaatca
gctatcttcagcctctggcatcgtcacttaccaagccttgaaagtgctacattaagtctt
ttagaccagctgacatcccttcagataaattctttggaaaaagtggcttgtgtcataaaa
gattctcttttgccacaagctgcaagtcatcctgccattttcagaattgttaatgaaatc
ttcaagaatgcactgttggaaaccgatggagctcctgaagttatgaccataatacaagta
tttatacagctcttcattcaggttcagcagaatgaaaacaagcagcataaatttcctctg
aaggcctacttccctcaccaccaccagcctcttgtaatagctttactaagacgccctttt
gaattgccatctacacactggctgcagcatttgaaacacatttcggatacactcaaatct
atagtagaagatacaaacgttagctcttttgctgacctttatgaaatctggtttttggtt
gcttgttttggagaatggctggatattgcagcagaacaattaatgaaagcagctgtagcc
ccagatgctttgctgtggctgttggctttttactactgtcctcagaatgaaaaccaacaa
aggactcaaacgatggtagaatctcaagcagtctacagtcgtctaatgatgctctacaac
cgtactgtcctttcatttggagatttgcaggcttctgtaaacaatgcagcagatacggaa
caatgtcatacccagtgtcttataacacatcttcttaccaactttttactcttttcttct
ggaggtcatatgattgcccaggaatttatttcccatattactgagacaactgacatgagc
aaggaagtttgtagccttcttatccgtactgcatacagaattaaacataatggaggagaa
aaccaaaggactgtgaagctgttgaatgaacttcttcaaaaactagcagtggaagtttag

DBGET integrated database retrieval system