KEGG   Gallus gallus (chicken): 427504
Entry
427504            CDS       T01006                                 

Gene name
BNC1
Definition
(RefSeq) zinc finger protein basonuclin-1 isoform X2
  KO
K24146  zinc finger protein basonuclin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    427504 (BNC1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    427504 (BNC1)
SSDB
Motif
Pfam: zf-met zf-C2H2 zf-C2H2_jaz zf-C2H2_4
Other DBs
NCBI-GeneID: 427504
NCBI-ProteinID: XP_004943880
CGNC: 4528
Ensembl: ENSGALG00000006041
Position
10
AA seq 985 aa
MENAIRCTLVSCSCQCFKPGKINQRQCDQCRHGWVAHALSKLRIPNLYPSSQVEIVQSNV
VFDISSLMLYGTQAIPVRLKILLDRLFSVLKQEEVIQILHALDWTLQDYIRGYVLQDASG
KVLDHWSIMTNDEELATLQQFLRFGETKSIVELMAIQEKEGQSIIIPPPTANLDIRAFIE
SCNQHSPNFSASLDKMSPTNIHPFENIVNNMAFMLPFQFFSPVPPPLIGSPPERHLIEQG
QDHSSETKQDIHLPFTESSFLTSSSAPFQAENERIINGPDVTTKTEDDALLSDSSSHNTA
AKLEMTALSPETKMKSVEKNGTGPRKGRVFCTACEKTFYDKGTLKIHYNAVHLKIKHKCT
IEGCNMVFSSLRSRNRHSANPNPRLHMPMNRNNRDKDLRNGLTIAGPGDSKRTEFTILAP
DSRTITSYASSCTDVKGQAGFPSIGQNGVLFPNLKTVQPVLPFYRSPVTPAELANTPGTL
PSLPLVSSSIPEQLISNELPFDVLPKKKSRKSSMPIKIEKEVVETPHESSDVASSEDDTR
LQVVSDGELESCEHKIEKQVSSGVENHPHSGNSWKSVSGVEGPKYFESVFAPDNQYIKDI
SENELHHCEKEVKPEENQPLKIVSHEIVYEDPIHHHNDVIKPMTESPIYVKEQSKRRISK
DDCPELQHHLLTGGFFSTLSNRGAAIACFEDSKDMDHVSQHALGIQKEESRFHCDICKKT
FKNPYSVKMHFKNVHLKEMHICTVEGCNAAFPSRRSRDRHSSNLNLHHKLLTKDTLEFNN
HFNATYLLKDMAKEFCQDVSLKQHGGHTSVIFKGMNRTGSLVFPMSKIREPCSESYGYDP
LNDGAVLDLSTTSSIKSESSAHSSWDSDGGSEVCTMPLDDSDESCEGPSLMPSDELYQDC
NLIEKANQNFINLPSSLPITCHICQKTYSNKGTFRAHYKTVHLRQLHKCKIPGCNTMFSS
VRSRNRHSQNPNLHRSLAGSPTSLQ
NT seq 2958 nt   +upstreamnt  +downstreamnt
atggagaacgctatccgatgcactctggtgagctgtagttgtcagtgtttcaaacccggg
aaaataaatcaacgacaatgtgaccagtgccggcatggatgggtagcacatgccctgagc
aaactaaggattcccaacctctatccatcaagccaggtggaaatagttcaatccaatgtt
gtctttgatatcagtagcctcatgctgtatggaacccaagctattcctgtgcgccttaaa
attctgctagatcggcttttcagtgttctgaagcaggaagaggtgatacagattctccat
gctctggattggacactacaggattatatacgtggatatgtgctgcaggatgcttcagga
aaggtgctggatcattggagcataatgaccaatgatgaagaattggctactttgcagcag
tttcttcgttttggagaaactaagtccattgtggagttaatggcaattcaggagaaagaa
gggcaatcaattataataccaccacctactgctaatttggatattagggcattcatagag
agctgcaatcaacatagccctaatttttcagcttccttggacaaaatgagccccaccaat
attcatccctttgagaatattgtgaataacatggctttcatgctgccgttccagtttttc
agtccggtgcctcctcctttaataggttcaccaccagaaagacacttgattgagcagggt
caagaccatagcagtgaaactaaacaagacatccacctaccttttactgaaagcagcttc
ctaacttctagttctgcaccatttcaagctgaaaatgagaggatcataaatggtccagat
gtcaccactaaaacagaagatgatgcccttttaagtgattcaagttcgcataatacagca
gcaaagcttgaaatgacagcactctctccagaaaccaaaatgaaatctgttgaaaaaaat
ggcactgggccaaggaaagggcgtgttttctgcactgcatgcgaaaagacattttatgac
aaaggtactttgaaaatacattataatgctgttcatctgaagataaagcacaaatgtaca
attgagggctgcaacatggtatttagctctttgcgtagtcgaaatcgtcatagtgcgaat
cctaaccccagactccatatgccaatgaacagaaataatagggacaaagatctaagaaat
ggtttgacaattgctggacctggagatagtaaaaggacagaatttacaattttagctccg
gatagcagaacaattaccagctatgccagctcttgtacagatgtaaagggccaggctgga
tttcccagtattggacagaatggtgtcctctttccaaatctgaaaacagtacagcctgtt
cttcctttctatcgtagtccagttacaccagctgagcttgctaatactccaggtactctt
ccttctctgcctcttgtttcttcctcgataccagagcagcttatttcaaatgaattgcca
tttgatgtgctacccaagaagaaatctcgtaaatcaagtatgcctattaagatagagaaa
gaagttgttgaaacacctcatgaaagtagtgatgttgccagttctgaagatgatacacgt
ctgcaagtggtaagcgatggagagcttgagtcctgtgagcataagatagagaagcaggtg
tccagcggggtggaaaatcacccccattcaggtaattcatggaaatctgtctctggggta
gagggcccaaagtattttgaatctgtctttgcaccagataaccaatacatcaaggatatc
tctgagaatgaattacatcactgtgagaaagaggttaaaccagaagaaaatcaaccatta
aaaatagtttcccatgagattgtatatgaagatccaatacaccaccacaatgatgttata
aaaccaatgactgaatcccccatatatgttaaagagcagtcaaaacgcaggatttctaaa
gatgactgccctgaattgcaacaccacttgctgaccgggggctttttcagcactttgtca
aacaggggtgctgccattgcttgttttgaagactctaaagatatggatcatgtcagccag
catgcactagggattcagaaggaagaaagccgctttcattgtgacatctgtaagaagact
tttaaaaacccttacagtgtaaaaatgcattttaaaaatgtacatctcaaagaaatgcat
atttgcacagttgagggctgtaatgctgctttcccttctcgtagaagtcgagacagacat
agttcaaacctaaatcttcatcataagcttctgactaaagatacactggaattcaacaac
catttcaatgcaacatacctcttgaaagacatggctaaggagttttgtcaagatgtctct
ttaaaacaacatggtggacatacttctgtaatcttcaaaggaatgaacagaacaggcagc
ttggtttttccaatgagcaaaattagagaaccttgttctgagagttacggatacgatcca
ttgaatgatggagctgttctggatctaagcactacttccagcattaaatctgagagcagt
gctcattcttcttgggattctgatggaggaagtgaagtgtgcaccatgcccttggatgat
agtgatgaaagctgtgaaggacccagcctaatgcccagtgatgaactctaccaagactgt
aatttaattgagaaagctaatcagaactttataaatctaccttccagtttgccaataact
tgtcacatatgtcaaaaaacttacagtaataagggaactttcagggctcactacaaaact
gtgcatctccgccagctccacaagtgcaaaatcccaggttgcaacactatgttttcatct
gttcgcagtcggaacaggcacagtcaaaaccctaatctgcacagaagtctggctgggtca
ccaactagcctacagtaa

DBGET integrated database retrieval system