KEGG   Gallus gallus (chicken): 427553Help
Entry
427553            CDS       T01006                                 

Gene name
CDH8
Definition
(RefSeq) cadherin-8
  KO
K06800  cadherin 8, type 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    427553 (CDH8)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Major cadherins
   427553 (CDH8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_4 Cadherin_2
Motif
Other DBs
NCBI-GeneID: 427553
NCBI-ProteinID: NP_001093759
CGNC: 53126
Ensembl: ENSGALG00000005319
UniProt: A6YJX2
Position
11
AA seq 799 aa AA seqDB search
MPERLTEMLMDTWTPLIILWITVLPSIYMAPMNQSQVLPSGSSTGLKRLTEEQRILNRSK
RGWVWNQMFVLEEFSGPEPILVGRLHTDLDPGSSKIKYILSGDGAGTIFVINDKTGDIHA
MKRLDREEKAEYTLTAQAVDRDTNKPLEPPSEFIIKVQDINDNAPEFVDGPYHATVPEMS
VVGTFVTKVTATDADDPVYGNSAKLVYSILEGQPYFSIEPHTAIIKTALPNMDREAKEEY
FVVIQAKDMGGHMGGLSGTTTVTITLTDVNDNPPKFAQSLYHFSVMEDVALGEPIGRVKA
NDLDIGENAKSSYDIIEGDGMDIFEITTDAQTQDGVIRVRKPLDFETKKSYTLKVEAANI
HIDPRFISGGPFKDTATVKIVVEDADEPPVFSSPTYLLEVHENAAINSVIGQVTAHDPDV
SSSPIRFSIDRHTDLERQFNINAEDGKITLATPLDRETNMWHNITIVATETRNHSQVSRV
PVTIKVLDVNDNAPEFASEHEAFLCENGKPGQVIQIVSAVDKDDPKNGHYFLYSLLPEMI
NNPNFTIKKNEDNTLSILAKHNGFSRQKQEVYLLPIIISDSGNPPMSSTSTLTIRVCGCS
SDGIVQSCNVEAYVLPIGLSMGALIAILACIILLLVIVVLFVTLRRHKNEPLIIKDDEDV
RENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDIKPDLQFMPRQGLAPVPNGVD
VDEFINVRLHEADNDPTAPPYDSIQIYGYEGRGSAAGSLSSLESSASDSDQNFDYLSEWG
PRFKRLGELYSVGESDKET
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaagactaacggaaatgcttatggatacatggactccattaataatattatgg
attactgtacttccttccatttatatggctccaatgaatcaatctcaagtactaccaagt
ggatccagtacaggactaaaaaggctaactgaagaacaaagaattttgaaccgttccaag
agaggctgggtttggaatcaaatgtttgtattagaagaattttctggacctgaaccaata
ctagttggccggttacatacagacttggatcctggcagcagcaaaatcaagtatattctg
tcaggagatggtgctggaactatctttgtgatcaatgacaagactggagacattcatgca
atgaaaaggcttgaccgcgaggaaaaagctgagtacactctaacagctcaagcagttgac
agggacacaaacaaacctctggagcctccttcagaattcattataaaggttcaagacatc
aatgacaatgccccggagtttgttgatggtccttatcatgccacagttccagagatgtct
gttgttggcacctttgttactaaagtaacagctacagatgcggatgatccagtttatgga
aacagtgccaagctggtttatagcattctggaaggacagccttacttttccattgaacca
catacagctataattaaaacagctcttcccaacatggacagagaagccaaagaagaatat
tttgtggttatccaggcaaaggacatgggaggacatatgggtggactttctggaactaca
acggtgacaattacactcactgatgttaatgacaatcctcctaagtttgcgcagagtctg
tatcacttctcagtaatggaagatgttgctcttggtgaacctataggaagggtgaaagca
aatgacctggatattggagaaaacgctaaatcatcatatgatattattgaaggagatgga
atggatatatttgaaatcactacagatgcccaaactcaggatggcgttattagagtgaga
aagcccctggactttgagaccaaaaaatcctatactctgaaggtagaagcagccaacatt
catattgatcctcgcttcatcagtggaggacctttcaaggatacagcaacagtaaaaatt
gtagtagaggatgctgatgagccaccagtcttttcatcacctacatacctactggaagtg
catgaaaatgctgctattaactctgtgattggtcaggtgacagcccatgaccctgatgtg
tcttccagtcctataaggttttccattgatcgtcatactgaccttgagagacagttcaac
attaatgcagaagatggaaaaataactttggcaacaccactcgacagagaaacaaatatg
tggcacaatataacgattgtagctactgaaactaggaaccacagtcaagtgtcccgggtg
cctgttactatcaaagttcttgatgtaaatgacaacgctcctgagtttgcatcagagcat
gaagcctttttatgtgagaatgggaagcctggacaagtaattcagattgtcagtgctgtt
gacaaagatgatcctaaaaatgggcattatttcttgtatagtcttcttcctgaaatgatc
aacaatccaaattttactatcaagaaaaatgaggataatactctcagcattttggcaaag
cataatggattcagtcggcagaaacaagaagtatacctactgccaatcataataagtgat
agtggaaatcctcccatgagcagtactagcactcttactattagagtctgcggttgcagc
agtgacggtattgtccagtcctgtaatgttgaagcatatgtacttcctattggactcagc
atgggagccctaattgcaatattagcatgcatcattttgctactagtcattgtggtgctg
tttgtaacactaagaagacataagaatgagcccttaatcatcaaagatgatgaagatgtg
agagaaaacattattcgctatgatgatgaaggaggtggagaagaagatacagaagctttt
gacattgcaacgttgcaaaatccagatggaattaatggatttttgcctcgtaaggatatt
aaacctgatcttcaatttatgcccaggcagggtcttgcacctgttcctaatggtgttgat
gttgatgaatttattaatgtaaggcttcatgaagccgataacgatcccacagctccacca
tatgactctatccagatttatggctatgaaggaagaggctcagctgctggttcccttagt
tcattggagtcctctgcatcagactcagatcagaattttgactacctcagtgaatggggt
cctcgctttaaaagacttggagaactttactcagttggagaaagtgacaaagaaacttga

DBGET integrated database retrieval system