KEGG   Gallus gallus (chicken): 427588
Entry
427588            CDS       T01006                                 

Gene name
KLF15
Definition
(RefSeq) Krueppel-like factor 15 isoform X3
  KO
K09210  krueppel-like factor 15
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    427588 (KLF15)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    427588 (KLF15)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC DUF5810 zf-C2H2_9 zf-met DUF2225 zf-Di19
Other DBs
NCBI-GeneID: 427588
NCBI-ProteinID: XP_004944662
CGNC: 4689
Ensembl: ENSGALG00000036133
UniProt: A0A1D5PL04
Position
12
AA seq 403 aa
MVDHLVPTDESFASTRSSLGYFRDMTAGVRSYQMLPSPLSEDDSDSSSFCSCSSPESQVL
SSSYGSTSSAESQDSILDYLLSQASLGNTAASWWDKRRLQPIVKEEYFRLPEFAVDMEDS
GPFQPTLEEIEEFLEENMELELKERPKSETKDLRACSQVSVASLQQKDHMLPNATLKESK
NEQLSSSTEGGQASNGGVSLENGIPVMLQIQPVQIKQESSTSPSSQGPAQENIKIAQLLV
NIQGQTFALVPQIVQSSNLNLPSKFVRIAPVPIAAKPIGPGGMIQGQTGIIMGQKFQKNP
AAELIKMHKCSFPGCTKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRR
SHSGVKPYQCPVCEKKFARSDHLSKHVKVHRFPRSSRSVRSVN
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggtggatcacctggtgcctactgatgaatcctttgcatctacaaggtcttctctggga
tactttagggacatgacagcaggggtgaggtcctaccaaatgctgccctctcctctgtca
gaagatgacagcgactcgtccagcttttgttcttgttccagcccggaatcccaggttctc
agctccagctatggaagcacatccagtgcggagagtcaggacagcatcttagactacttg
ctgtcccaggcatctttggggaacaccgctgcgtcatggtgggacaaaaggagacttcag
cccatagtgaaagaggagtattttaggttgcctgaattcgctgtggatatggaagattct
ggaccatttcagcccacgcttgaggaaattgaggaatttctggaagaaaacatggagctg
gagctcaaagaaagacctaaaagtgagaccaaggacttgagagcttgcagccaagtttct
gttgcttcgctacagcaaaaagaccatatgttacccaatgctactttaaaagagagtaaa
aatgaacagttgagcagctcaacggaaggtggccaagcttcaaatggaggagtgtccctg
gagaatggcataccggttatgctccaaattcagcctgtacagatcaaacaggagtccagc
acgagccctagttcccaaggaccagcacaggagaacattaaaattgcacagctcctagtc
aacatccaaggacagacatttgcccttgtgccccagatagttcagtcatccaatttgaac
ttgccctctaaatttgtccgcattgctcctgtccccatcgctgccaagccgattgggcca
ggaggcatgatccagggtcagacgggaatcatcatgggtcagaaatttcaaaagaaccct
gcagcagaactcattaaaatgcacaaatgttctttccctggttgtaccaagatgtacacg
aaaagcagccatttgaaagcccacctgaggaggcatacgggagaaaagccgtttgcttgc
acgtggccaggttgcggatggaggttctccaggtcggatgagctgtctcggcaccggcgc
tcccactcgggggtgaaaccctatcagtgtcccgtctgcgagaagaaatttgcccgaagc
gaccacttgtccaaacacgtcaaggtgcatcggttcccgcgaagcagccgctctgtgcgc
tccgtgaactga

DBGET integrated database retrieval system