KEGG   Gallus gallus (chicken): 427590Help
Entry
427590            CDS       T01006                                 

Gene name
BRPF1
Definition
(RefSeq) peregrin
  KO
K11348  bromodomain and PHD finger-containing protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    427590 (BRPF1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    MOZ/MORF complex
     427590 (BRPF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H_2 EPL1 zf-HC5HC2H Bromodomain PWWP PHD_2 PHD
Motif
Other DBs
NCBI-GeneID: 427590
NCBI-ProteinID: NP_001026635
CGNC: 53141
Ensembl: ENSGALG00000033529
UniProt: Q5F3S4
Position
12
AA seq 1218 aa AA seqDB search
MGVDFDVKTFCHNLRATKPPYECPVGSCRKIYKSYSGIEYHLYHYDHDNPPPPQQPPLRK
HKKKGRQGRAGAADKQSPNPSEASQSPGREVMTYAQAQRMVEVDLHGRVHRISIFDNLDV
VSEDEEAAEEAPENGGSKENGESQAAAAAAAAPKSAKQKSKEKRKDSNHHHHHNASAGAA
PKLPEVVYRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRK
TEGVSPIPQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFC
DMCNLAVHQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVC
ALWIPEVCFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTC
AQQAGLYMKMEPVRETGANGTSFSVRKTAYCDIHTPPGSVRRLPALSHSEGEEEDEEEEE
EGKSWSSEKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRK
SQFMQRLHSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQRDTEDKNWALKEQLKSWQRLR
HDLERARLLVELIRKREKLKRETIKVQQVALEMQLTPFLILLRKTLEHLQEKDTGNIFSE
PVPLSEVPDYLDHIKKPMDFQTMKQNLEAYRYLNFDDFEEDFNLIINNCLKYNAKDTIFY
RAAVRLREQGGVVLRQARRQAEKMGIDFETGMHFPHCVTVEEAQVQDIEDEDMRLLLSEN
QKHLPLEEQLKILLERLDEVNAGKQSIGRSRRAKMIKKEITVLRRKLAHPRDLGRDGLER
HSSSARGVLQSHNPCEKDLQTDSAAEESSSQETGKGLGPNSSSTPAHEVGRRTSVLFSKK
NPKTAGPPKRPGRPPKNRDSQIAPGHGNSPIGPPQLPIMGSSQRQRKRGRSPRPSSSSDS
DSDKSTEDAPMDLPANGFSSGSQPVKKSFLVYRNDCNLPRSSSDSESSSSSSSSAASDRT
STTPSKQGRGKPSFSRVNFPEDSSEDTSGTENESYSVGAGRGVGHSMVRKGIGRGAGWLS
EDEDSSLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQ
EAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRAM
QHRNKVQGEQSSDSSESD
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcgacttcgacgtgaagacgttctgccacaacctgcgggccaccaagccgccc
tacgagtgcccggtgggcagctgccgtaagatctacaagagctacagcggcatcgagtac
cacctgtaccactatgaccacgacaacccgccgccgccgcagcagccgccgctccgcaag
cacaagaagaagggccgccagggccgcgccggcgccgccgacaagcagtcccccaacccc
tcggaggcgtcgcagtctccgggccgcgaggtgatgacctacgcgcaggcccagcgcatg
gtggaggtggacctgcacggccgcgtgcaccgcatcagcatcttcgacaacctggacgtg
gtgtcggaggacgaggaggccgccgaggaggcgccggagaacggcggcagcaaggagaac
ggcgagagccaggcggccgccgccgccgccgccgcgcccaagtcggccaagcagaagagc
aaggagaagcgcaaggactccaaccaccaccaccaccacaacgcctcggccggcgcggcc
cccaagctgcccgaggtggtgtaccgcgagctggagcaggacacgcccgacgcgccgccg
cgccccacctcctactacaggtacattgagaagtcagcggaggagctggatgaggaggtg
gagtacgacatggacgaggaagattacatctggctggatatcatgaacgagcggcggaag
acagagggcgtcagtcccattccccaggagatctttgagtacctgatggacaggttggag
aaggagtcgtacttcgagagccacaacaagggggaccccaacgccttggttgacgaggat
gccgtgtgctgcatctgcaatgacggggagtgccagaacagcaatgtcatcctcttctgt
gatatgtgcaacctggccgtgcaccaggagtgctacggggtgccctacatccctgaggga
cagtggctctgcaggaggtgcctgcagtcaccctcgcgagccgtggactgcgccctgtgc
cccaacaagggcggcgcgttcaagcagacggacgatgggcgctgggcacacgtggtctgt
gccctctggatcccagaggtgtgctttgccaacacggtcttcctggagcccatagacagc
atcgagcacatcccccccgcgcggtggaagctgacctgctatatttgcaagcagcgcggc
tctggggcttgcatccagtgtcacaaggcaaactgttacaccgctttccacgtcacctgt
gcccagcaggctggactctacatgaaaatggagcccgtccgtgagacgggagcaaacggg
acctccttcagcgtgcgtaaaactgcctactgtgacatccacacacctccaggctccgtg
cgcaggcttcccgcgctctcccacagcgaaggagaagaggaggatgaggaggaggaggag
gaaggaaagagctggagctccgagaaggtgaaaaaggcgaaggccaagtctagaatcaaa
atgaagaaggcgcggaagatcctggcagaaaaacgagctgcagcacctgtggtttctgtt
ccctgcatccccccccacaggctcagcaagattactaatcgtctaactatccagaggaag
agtcagttcatgcagaggctgcacagctactggactctgaagaggcagtcccgcaacggt
gtccccctgctgcgccgccttcagacacacctgcagtcccagaggaactgtgatcagaga
gacactgaggataagaactgggccctgaaggagcagctgaagtcatggcagcgcctccgc
catgacctagagcgcgcgcgcttgctggtggagctgatacgcaagcgggagaagctcaag
agagagacgatcaaagtgcagcaggtggcactggaaatgcagctgacccccttcctcatc
ctcctccgcaagacgctcgagcacctgcaggagaaagacacgggcaacatcttcagtgag
ccggtccctctgtctgaggtcccagactacttggatcacatcaagaagccgatggatttt
cagacaatgaaacaaaacctggaagcgtaccgttatctgaattttgatgactttgaggaa
gatttcaacctgattatcaacaactgtttgaaatacaatgccaaagacactatcttctac
cgggcggccgtccgtctgcgggagcagggaggcgtggttctgcggcaggctcgccggcag
gcagagaagatgggcattgactttgagacaggcatgcacttcccacactgcgtgactgta
gaagaggctcaggtccaggacattgaggacgaagacatgcgactgctgctctcagaaaat
cagaagcacctgcccctagaggagcagctgaagatcttgctggagcggctggatgaggtc
aatgctggcaagcagagcataggacggtcccgccgggccaagatgatcaagaaggagatc
acggtcctgcggcggaagctggcacacccccgggacctgggccgagatgggctggagagg
cacagctcctctgccaggggggtcctgcagtcgcacaacccctgcgagaaggaccttcag
acagacagtgctgctgaggagagcagcagccaagagactggcaaaggtctgggtcccaat
tcttcttccactccagcacatgaagtgggcaggaggacctcagtgctcttctccaagaag
aaccctaaaactgcaggacctccaaaacgtccaggacgtccccccaagaatcgagacagc
cagatagctcccgggcatgggaacagccccataggccccccgcagctccccattatgggg
tcctcccagcggcagaggaagcgggggcgaagcccacgtcccagctccagctccgatagc
gacagcgacaaatccactgaagacgctcccatggacctgccggccaatggcttcagcagt
gggagccagccagtgaagaagagcttcctggtgtaccgcaacgactgtaatcttccacgc
agcagctccgactccgagtccagcagcagcagcagcagcagtgctgcctcagaccgtacc
agcacaacgccctcaaagcagggcagggggaagccctccttctcccgcgtgaacttccct
gaggacagcagcgaggacacatcaggaacagagaacgaatcctactctgtgggtgctggg
cgaggcgtggggcacagcatggtgcggaagggcattggccgtggtgcagggtggctctct
gaggatgaggattcttccctggacgctttggatctggtgtgggccaagtgccggggctac
ccctcctacccggcactgatcatcgaccccaagatgccgcgggagggcatgttccaccac
ggcgtccccatccccgtgccgccgctggaggtgctgaagctgggcgagcagatgactcag
gaagcgcgcgagcacctctacctcgtcctcttcttcgacaacaagcgcacttggcagtgg
ctgccccgcaccaagctggtgccgctgggcgtcaaccaggacctggacaaggagaagatg
ctggagggccgcaagtccaacatccgcaagtcggtgcagatcgcctaccaccgcgccatg
cagcaccgcaacaaggtgcagggcgagcagagcagcgactccagcgagagcgactga

DBGET integrated database retrieval system