KEGG   Gallus gallus (chicken): 427591
Entry
427591            CDS       T01006                                 

Gene name
FAM107A
Definition
(RefSeq) protein FAM107A isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: DUF1151 TOPRIM_C
Other DBs
NCBI-GeneID: 427591
NCBI-ProteinID: XP_004944702
CGNC: 5394
Ensembl: ENSGALG00000007139
UniProt: F1N8P4
Position
12
AA seq 175 aa
MGGAHGKKKEYSLQPRCAGSSRRPTSGSSASMYTEIQQEHSDSASILTHPDYIDGNPDLI
KPKKLLNPVKASKSHQELHRELLMNHKRGLSVDSKPELQRVLEHRRRNQVLRQKKEEEEA
KKLQSPFEKELLKRHQRLDQLEKEQEKQEDHAPEFIKVKENLRRTSTVTGEEKAA
NT seq 528 nt   +upstreamnt  +downstreamnt
atgggaggagcgcacgggaagaagaaggaatattccctccagccccggtgtgctggcagc
agcaggaggcccacaagtggcagttcagcgtcgatgtacacagaaatacagcaggagcac
tctgacagtgcgagcatcctgactcacccggactacatagatgggaacccagacctgatc
aaacctaaaaagcttctcaaccctgtcaaagcctccaagagccaccaggagctgcatcga
gagctgctgatgaaccacaagagaggcttgagtgtagacagcaagccggagttgcagagg
gtgcttgagcaccgacggcgaaatcaggtcctcaggcagaagaaggaagaggaagaggcc
aagaagttgcagtctccctttgaaaaagagctactgaaaaggcaccagaggctggatcag
ctggagaaagagcaggagaagcaggaagaccatgcaccagaattcattaaagtcaaagaa
aatctgagaaggacatcaacggtgactggggaagagaaagcagcatag

DBGET integrated database retrieval system