KEGG   Gallus gallus (chicken): 427606
Entry
427606            CDS       T01006                                 

Gene name
NRG2
Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform isoform X1
  KO
K05456  neuregulin 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    427606 (NRG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    427606 (NRG2)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   427606 (NRG2)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set C2-set_2 EGF DUF3169 Ig_6 EphA2_TM Izumo-Ig TMEM132D_C
Other DBs
NCBI-GeneID: 427606
NCBI-ProteinID: XP_015149030
CGNC: 611
Ensembl: ENSGALG00000033641
Position
13
AA seq 742 aa
MRRDPAPGFSMLLFGVSLACYSPSLKSVQDQAYTAAVVLEGKVQSVAPPAGGGNDSRGAS
GPAGGVLVKVLDLWPLNSGGLQREQLISVGSKAPCFKVKRNHRYIFFLEPTEEPLVFRTA
FAPLDTSGKNLKRDVARILCADCAVPPKLKKLKSPNVHVGEKISLKCEATAGNPQPSYKW
FKDGKELKKSKDIRIKYGNGKKISRLQFNKVKLEDAGEYSCEAENILGKDTAKGSLNVRS
GTTKAPQVLPASETKIVVMEEELTTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQL
SCKCPIEFTGDRCQHFAMVSFSKHLGFELKEAEELYQKRVLTITGICVALLVVGIVCVVA
YCKTKKQRKQMHNHLRQNMCHAHQNRSLANGPSHPRLDPEEIQMADYISKNVSATEHVIR
RETETTFSGSHSCSPSHHCSTATPTSSQRHESHTWSLERTESLTSDSQSGIMLSSVGTSK
CNSPACVEARARRGAAFCIEDSRRPTTQYRDSVDSLRDSPHSERYVSALTTPARLSPVDF
HYSMAAQVPTFEITSPNSAHAVSLPPAAPVSFRVEEQQPLLRRYQLPFQDTQRYDSYYQR
KTYLNDSMGSLPSSPFRITEDDEYETTQEYVTALEQPKKTASSNRRWKKSKLNGHVPHRA
RAVRDSFSFSSASYSESDEELVAESTPFLSTQNNEATNTESPPLHRPGDSRTQHPYSRHS
AHGGSGRSSLAHTTPKREPDPL
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgaggcgcgacccggcgcccggcttctccatgctgctcttcggcgtctcgctcgcctgc
tactcgcccagcctcaagtcggtgcaggaccaggcgtacacggcggccgtggtgctggag
ggcaaggtgcagtccgtggccccccccgcaggcggcggcaatgacagccgcggcgcctcc
ggccccgccggaggggtcctggtgaaggtgctcgacctgtggcccctcaacagcggcggg
ctgcagcgggaacagctcatcagcgtgggctccaaggcgccctgcttcaaagtgaagcgc
aaccaccgctacatcttcttcctggagcccacagaggagccgctcgtcttccgcaccgcc
ttcgcccctctcgacaccagcggcaagaacctcaagcgggacgtggcgcggatcctctgc
gcggactgcgctgtccctcccaaactgaagaaactgaaaagcccaaacgttcacgttggt
gaaaagatctcactgaaatgtgaagcgactgctggcaaccctcagccatcctacaaatgg
tttaaagatggcaaagagctgaagaagagcaaagacatccggatcaagtatgggaatggg
aaaaagatttccagactgcagttcaacaaggtgaagctggaagatgctggggagtacagc
tgcgaagcggagaacattttagggaaagacaccgcaaaaggcagcctgaatgtgagaagt
ggaacaacgaaagcaccacaagttttaccagcctcagaaactaaaatagttgttatggaa
gaagagttaaccacaactctctcctcctggtctgggcatgctagaaaatgcaacgaaaca
gccaagtcctattgtgtcaatggaggagtatgctactacatcgaagggattaatcagctg
tcttgcaagtgtccgatcgaattcacaggagaccggtgtcagcatttcgcaatggtcagc
ttctccaagcatcttggatttgaattaaaggaggcagaggagctctaccagaaaagagtt
ttaaccatcacaggaatctgtgttgccttgcttgtggtgggcatcgtctgtgtggtagct
tactgtaaaaccaagaagcaaagaaaacagatgcataatcatttacgacagaacatgtgt
catgcccatcagaacaggagccttgcgaatgggccaagccatccgcgtttggatccagag
gaaatccaaatggctgattatatttctaagaatgtttctgccaccgaacacgtgatccgg
agggaaacagagacaaccttttcaggaagtcactcctgctcaccatcacatcactgctcc
acagctactccaacatccagtcagagacatgaaagccacacctggagcctggagcggacg
gagagcctgacttctgattcccagtctgggatcatgctgtcctcggtgggaaccagtaaa
tgcaacagccctgcatgtgtggaggcgcgggcccgccgtggggctgccttctgcattgag
gactcgcggcggcccacgacgcagtaccgcgactcggtggactcactgcgggactcacca
cacagcgagaggtacgtgtcggccctgaccacaccagcacgcctgtcgcctgtcgacttc
cactactcgatggcggcacaggtgcccaccttcgagatcacctcccccaactccgcgcat
gccgtctccctgccgccagcagctcccgtcagcttccgcgtggaggagcagcagccgcta
ctgcggcggtaccaactgcccttccaggacacgcagcgctacgacagctactaccaaagg
aagacctacctgaacgacagcatggggagcctgccctccagccccttccgcatcacggag
gacgacgaatatgagacgacgcaggagtacgtcacagcgctagagcagccaaagaaaaca
gccagcagcaacaggcggtggaaaaagtccaaactgaacgggcacgtcccccacagagcc
agagctgtccgggactccttctccttcagcagcgcctcttacagcgagtctgatgaggag
ctggtggccgagagcacgcccttcctaagcactcagaacaatgaggcgacaaacacagag
tcgccaccgctccaccggccgggcgacagccggactcagcacccctacagccggcacagc
gcccacgggggcagcgggcgcagcagcctggcgcacacgacgcccaaacgagagcctgac
cccctctag

DBGET integrated database retrieval system