KEGG   Gallus gallus (chicken): 427613
Entry
427613            CDS       T01006                                 

Gene name
FOXI1
Definition
(RefSeq) forkhead box protein I1
  KO
K09401  forkhead box protein I
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    427613 (FOXI1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    427613 (FOXI1)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 427613
NCBI-ProteinID: XP_425185
CGNC: 1498
Ensembl: ENSGALG00000002105
UniProt: E1BR13
Position
13
AA seq 375 aa
MSSFDPQTHSPPRCSPQFPNIGQEPPEMNIYYENFFHPQNIPSPQRPSTFETTDYNSTPN
PYLWLNGPSITPPPYLPGSNASPFIPQSYGMQRQLLPNMHGLGGTDLGWLPLPSQEELMK
LVRPPYSYSALIAMAIHGAPEKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDC
FKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDIGASSAHLTSEKSEDSALT
GSPKAVEHQDLLENSSSGTDNPPDKGSPPPSSSSPCLSNFISSMTAYVNGSNSVGRSVPL
GLNAEPTDKMGQNMVGLNSYSPLSNVPSHGVGEWSNSMPPSHLGYSNSVLNQFNTHFYSS
ISTNNTLFSREGTEV
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgagctcctttgatccacaaacgcactctccaccacgctgcagcccacaatttccaaat
atcggtcaagaacctccagaaatgaatatctactatgagaacttcttccacccacagaat
attcctagtccgcagcgaccgagcacctttgagacaacggactacaacagcacacctaat
ccttacctctggctaaacggaccttccattactccaccaccgtatctcccgggatccaat
gccagtcccttcattcctcagtcttatgggatgcaaaggcagctcctgcctaacatgcac
ggcttgggaggaactgatcttggctggcttcctcttccatcccaagaagagcttatgaag
ttggttagaccaccttactcctactctgcacttattgccatggctatccacggagcacca
gaaaagaggttgactctcagtcagatctaccagtacgtggctgacaacttcccattttac
aacaaaagcaaagctggctggcagaactcaattcggcacaacttgtctctcaacgattgt
ttcaagaaggtgcctagagatgaagatgatccaggaaaagggaattactggactctggac
ccaaactgtgaaaagatgtttgacaatggcaactttcgcaggaagaggaaaaggaagtct
gatattggggctagttctgcccatctgacatctgagaaatccgaggacagtgccttgact
ggcagccccaaagctgtggagcatcaggatcttttggaaaactcttcatctgggactgac
aatccacccgataaaggatctccacctccatcttccagtagcccatgccttagtaatttc
atttccagtatgactgcatatgttaacggctctaattcagtgggccgctcagtgccattg
ggacttaatgctgaacccactgacaaaatgggacagaatatggtaggcttaaattcctac
tctccactctctaatgtccccagtcacggtgtgggagagtggtccaattctatgcctcct
agtcaccttggctatagcaattcagtgctcaaccagtttaacacccatttttacagtagt
atcagcacaaataacactctgttttccagggaggggacagaggtttaa

DBGET integrated database retrieval system