KEGG   Gallus gallus (chicken): 427636
Entry
427636            CDS       T01006                                 

Gene name
NMUR2
Definition
(RefSeq) neuromedin-U receptor 2
  KO
K05053  neuromedin U receptor 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    427636 (NMUR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    427636 (NMUR2)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Peptide
   Neuromedin U
    427636 (NMUR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw 7tm_4
Other DBs
NCBI-GeneID: 427636
NCBI-ProteinID: NP_001305366
CGNC: 3007
Ensembl: ENSGALG00000004101
UniProt: E1BX29
Position
13
AA seq 395 aa
MAWIGNSSWFNHLALQEHFRRYLNSTEDYLAFLCGPKRSHLFLPMALVYSVIFVVGVIGN
FLVCLVILKHQNMKTPTNYYLFSLAVSDLLVLLFGMPLEVYEMWSNYPFLFGPIGCYFKT
ALFETVCFASILSVTTVSIERYFAILHPFRAKLESTRKRALRTIVVLWVLSVLFALPNTG
THGIMLQYFPNGTLVPGSATCTVVAPMWIYNWIVQITSFLFYVLPMGVISVLYYLMGLRL
KGDRSLEAEEMSVNVQRPSRKSVTKMLFVLVMVFAVCWAPFHIDRLFFSFVVEWTEPLAN
IFNLIHVVSGVFFYLSSAVNPIIYNLLSQRFRMAFLSVISPGCKHWAPKHTTSKTPPQQS
IFMVEDHNLVDSAEDTSVPGTNRTSVCSSQLSTGL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcctggatcggcaattcctcctggtttaatcaccttgctctgcaggaacatttcagg
aggtacttaaacagcactgaggattatttagccttcctatgtgggcccaaacgcagccat
ctgttcttgcccatggctctggtgtactctgtgatcttcgttgttggggtgatcggtaac
ttcctagtttgcctggtgatccttaagcaccagaacatgaagaccccaaccaactactac
ctcttcagcctcgccgtgtctgacctgcttgtgctactttttgggatgccactggaagtc
tatgagatgtggagcaactaccccttcttgttcggtcccatcggctgctatttcaagaca
gctctctttgagacagtgtgctttgcctccatcctcagcgtgaccacagtcagcatcgag
agatactttgccatcctccatcccttccgtgccaagctggaaagcactcgcaagcgtgcc
ctgaggaccatcgtggtgctctgggtcctctctgtcctctttgccctccccaacacgggc
acccatggtatcatgctgcagtatttccccaatggcaccttggtccctggctctgccacc
tgcactgtggtcgcacccatgtggatctacaactggattgtccagattacttccttcctc
ttctatgtgctgcctatgggggtcataagtgtgctgtactatctgatggggttaagactg
aaaggagacagatctttggaagcagaggaaatgtccgtgaatgttcagaggccatccaga
aaatcagtcaccaagatgttgtttgtccttgtgatggtttttgctgtctgctgggctcca
ttccatatagatcgcctcttcttcagctttgttgtggaatggactgagcctctggctaat
atattcaatttaattcatgtggtgtcaggtgttttcttctacctgagctctgctgtgaac
cccatcatctacaacctgctgtcccagcgcttcaggatggcgttcctcagcgtcatctcc
cctggctgcaagcactgggcccctaagcacactaccagcaagactcctccccagcagagc
atcttcatggttgaagaccacaatctcgtggactctgcagaagacacaagtgtgcctggc
accaacaggacatctgtctgcagttctcagctctccactggcctgtga

DBGET integrated database retrieval system