KEGG   Gallus gallus (chicken): 427638
Entry
427638            CDS       T01006                                 
Symbol
GPX3
Name
(RefSeq) glutathione peroxidase 3 precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00480  Glutathione metabolism
gga00590  Arachidonic acid metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    427638 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    427638 (GPX3)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     427638 (GPX3)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 427638
NCBI-ProteinID: NP_001156704
CGNC: 53151
Ensembl: ENSGALG00000004521
Position
13:complement(13762664..13764657)
AA seq 219 aa
MGCRAACVLAVLLAGLVPLGQGQEREKVKCYDSVRGTIYDYGALTIDGDEYIPFRKYAGK
MVLFVNVATYUGLTLQYLELNALQNELGPYGLVVLGFPSNQFGKQEPGQNSEILPALKYV
RPGGGFVPNFQLFQKGDVNGAKEQKVYSFLKNSCPPVAEEFGNPKNLFWEPLRNHDIKWN
FEKFLVGTDGVPVMRWYHRANIATVKNDIIAYMRQQRGQ
NT seq 660 nt   +upstreamnt  +downstreamnt
atggggtgccgagccgcctgcgtgctggccgtgctgctggccgggctcgtcccgctgggg
cagggccaggagagggagaaggtgaaatgctacgactccgtgcggggcaccatctacgac
tacggggcgctgaccatcgatggggacgagtacatccccttccgaaagtacgcggggaag
atggtgctctttgtcaacgtggccacgtactgagggctcaccctgcagtacctcgaactg
aatgcactacaaaatgagctggggccctatggacttgtcgtcctgggcttcccctccaac
caatttgggaagcaggagcctggccagaactccgagatcctccctgcactgaagtacgtg
cggccaggaggtggcttcgtccccaacttccagctcttccagaaaggggatgtgaacggg
gccaaggagcagaaggtctacagcttcctgaagaactcctgccctccggtggcagaggag
ttcggcaaccccaagaacctcttctgggagccgctgaggaaccacgacatcaaatggaac
tttgagaagttcctggtgggcactgacggggtgcccgtcatgcgttggtaccaccgcgcc
aacatcgccactgtcaagaacgacatcatcgcctacatgcggcagcagcggggccagtag

DBGET integrated database retrieval system