KEGG   Gallus gallus (chicken): 427658
Entry
427658            CDS       T01006                                 

Gene name
MAD1L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1 isoform X2
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04110  Cell cycle
gga04114  Oocyte meiosis
gga04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    427658 (MAD1L1)
   04114 Oocyte meiosis
    427658 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    427658 (MAD1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    427658 (MAD1L1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     427658 (MAD1L1)
SSDB
Motif
Pfam: MAD TSC22
Other DBs
NCBI-GeneID: 427658
NCBI-ProteinID: XP_004945193
CGNC: 3103
Ensembl: ENSGALG00000004224
UniProt: E1BRU0
Position
14
AA seq 717 aa
MEDLEDNTTVFSTLRSFNNFISQRMEGVSGQAVPASSQSSLQIQYQQRVQLEEQAGQIHS
KSQLLQMEREKMQMELSHKRARIELEKAANTNARNYEREADRNQELLTRIKQYQERETEA
ENKLKEQMEMNKSYKKSMETMSKKLQEKESKLAEANETITILKGKISELQWNIMNQEMQM
TSQDSQKQELMEQLDVQHKKWQEATQQIQTLQASQSLLAEYEQKIKDLEQKFSQQEHDAV
IVKNMKTELARFPKMERELRQLREENAYFREMKENNGLLKEEVEGLQRKLERYEKVQAQL
VTAELENEKLLGKLKSWEKLDQSTGLNIRTPDDLSRQIVALQQRELALKEQNSTITNSAR
IMEKARQQLQEEILQIQSQLLDEKKKREQHEALVRRLQKRVLLLTKERDGMRAILESYDS
ELTPAEHSPQLNRRMREAEEMVQKLHAHNAELEVQMSQVLEEVGNQKQRAEMLEVEMKVL
KSRECTAEQSAFITKEEVDTLRLKIEELEAERSKLEEQNRSLEMKLEKLTMQGDYDPSKT
KVLHFSMNPASLAKQQRKEEQQQLQEECERLRELVRVLEAGGSVHGNLEGVGSFQSPQEV
AELKKQVESAELKNQRLKEIFQTKIQEFRKVCYTLTGYQIDITTENQYRLTSIYAEHQGD
CLLFKASSSSGGKMQLLENEFSRTVRELIELHLLHQDSIPAFLSALTLELFSRQTIA
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggaggacttggaagataataccactgtcttctccaccctgagatccttcaacaacttc
atttcacagcgtatggagggggtgtccgggcaggctgtgccagcgtcgtctcagagctcc
ttgcagattcagtaccagcagagggtgcagttggaagaacaagctgggcagatccattcc
aaatcgcagctcctgcagatggagcgggagaagatgcagatggagcttagccacaaacga
gctcgcattgagttggagaaggcagctaacactaatgccagaaactatgagcgagaggct
gaccgtaaccaggagctgctcacacgcataaagcagtatcaggaaagggaaacggaagct
gaaaataaactgaaggagcaaatggagatgaacaaatcctataagaagagtatggagaca
atgagtaagaaactgcaagagaaggagagcaaattagctgaagctaatgaaacaatcact
atactaaaagggaagatatctgagctacaatggaatataatgaatcaagagatgcagatg
acaagccaagactcacagaagcaagagctgatggaacagctggatgttcaacataagaaa
tggcaagaggctactcagcaaatccagacattgcaagcaagccagtccctactggcagaa
tatgaacagaagattaaggatctggagcagaagttctcccagcaggaacatgatgctgtt
atcgtcaagaacatgaagacagaactggcccgtttcccaaaaatggagcgggagctgcga
cagcttagggaggaaaatgcatacttcagggagatgaaagaaaacaatggattgcttaaa
gaagaagtagaaggtctccaaagaaaattggaacgctatgagaaagtccaagcacagtta
gtgactgctgaattggaaaatgagaaacttctgggaaaactaaaaagctgggagaaactg
gaccagagcactggcttgaatatcaggacacctgatgatctctcaaggcaaattgtggcc
ctgcagcaaagggagcttgcgctgaaagagcagaactctaccatcacaaacagtgcccga
ataatggagaaggcccggcagcagctgcaggaggaaattctacagatccagagccagctc
ctggatgagaagaagaagcgtgagcagcacgaggccctggtcaggcggctgcagaaacgt
gtgctgctgctcaccaaggagcgtgatgggatgcgagcaatcctggagtcgtatgacagc
gagttgacccctgcagagcactccccacagctgaaccggcgcatgcgggaggccgaggag
atggtgcagaagctgcacgctcataacgccgagctggaggttcagatgtctcaagttctg
gaagaagtgggaaatcagaagcaaagagcagagatgctggaggtggagatgaaggtcctg
aagtctcgagagtgcaccgcagagcagagtgccttcatcaccaaggaggaggttgacaca
ctcaggctgaagattgaggagctggaagctgaacgcagcaagctggaagagcagaacaga
tctctggaaatgaagctggagaagctaactatgcagggtgactatgaccccagcaaaacc
aaagtgcttcacttcagcatgaacccagcaagcctggccaagcagcagcgcaaggaggag
cagcagcagctgcaggaggagtgtgagaggctgagggagctggtgagggtgctcgaagcc
ggcggctcagtccatgggaatctggaaggagttgggagctttcagtcaccgcaggaagtt
gcagagctgaagaagcaagtggaaagcgcagaactaaaaaaccagcggctgaaggagatt
tttcagaccaagatccaggagtttcgcaaggtctgttacacactcactgggtaccagatc
gacatcaccactgagaaccagtatcgactcacctccatttacgccgagcaccaaggagac
tgcctgctcttcaaggcctccagctcgtctggtggaaaaatgcaacttctggaaaacgag
ttctcgcggaccgtccgggagctcatcgagctgcacctgctgcaccaggacagcatccct
gccttcctcagcgccctcaccctggagctgttcagccgtcagaccatcgcgtag

DBGET integrated database retrieval system