KEGG   Gallus gallus (chicken): 427775Help
Entry
427775            CDS       T01006                                 

Definition
(RefSeq) cholesterol 7-desaturase-like
  KO
K14938  cholesterol 7-desaturase [EC:1.14.19.21]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.21  cholesterol 7-desaturase
     427775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rieske Rieske_2 PROL5-SMR
Motif
Other DBs
NCBI-GeneID: 427775
NCBI-ProteinID: XP_425346
CGNC: 53186
Ensembl: ENSGALG00000045310
Position
17
AA seq 415 aa AA seqDB search
MGWCGTELLAAGLGDGAPLFFLLLFLLLVLLPGCWRPLELRRAPGRVGYLPGLGPSRGLS
ARRSRRPGALPPPYPNGWYRVLDSAQLPRGAVRSLALLGERLAAFRTQDGQAHVVDAYCP
HLGADLAAGGRVVGSCIECPFHGWRFRGEDGKCTHIPYAGKVPDFAKVRSWPCCEVNGML
LLWYHCDGTGPAWAVPEQPEIITGDWVFRGQTEHFVDAHIQEIPENAADTAHLAFLHGPA
ILSGSDLRYTKSRLWDFMKHVWKAEWQPEPEPHRHCSHMQLQHTATIFGRRFPLLDLSVS
ARQVGPGLVFLIFKHAFLGHGIILQTVTPLEPLLQNVVHKIYYQKNVPAIIPKFILRAEC
IQFERDVTIWNNKQYLPRPLLVCEDAGIQKHRRWFAQFYSERSTRPSVPKGDLDW
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggggtggtgcggcacggagctgctggccgcggggctgggggacggggcgccgctcttc
ttcctcctcctcttcctactcctcgtcctgctgcccggctgctggcggccgctggagctg
cggcgtgccccgggccgggtgggctacctgccgggtctcggcccgagccgtgggctctct
gcccgtcgctcccgtcggcccggagcgctgccgccgccctaccccaacggctggtaccgc
gtcctcgactccgcgcagctgccccgcggcgccgtccgcagcctcgctctgctcggtgag
cgtctggccgcgttccgcacgcaggacggccaggcgcacgtggtggatgcgtactgccca
cacctcggtgctgacctggctgctggcggccgcgtcgtgggcagctgcatcgagtgcccc
ttccacggctggcgcttccgaggagaagatggaaaatgcacccacatcccatatgctgga
aaagtgccagattttgccaaggtgcggagctggccgtgctgcgaggtgaatgggatgctg
ctgctctggtaccactgcgacgggaccggccctgcttgggctgtgcctgagcagccagag
atcatcaccggggattgggtgttccgggggcagacggagcacttcgtggatgcacacatc
caggaaatccctgagaacgcagctgacacagctcacctggccttcctgcacggcccagcc
attctgagcggatccgacctgagatacaccaagtccaggctgtgggacttcatgaagcac
gtctggaaggccgagtggcagccagagccggagccccacaggcactgctcccacatgcag
ctccagcacacagccaccatctttgggaggcgtttccctttgttggacctgtcggtgtca
gcccggcaggtgggaccagggctggtcttcctcatcttcaaacacgcgttcctgggccac
gggatcatcctgcagacggtgacacccctggagcctctcctgcagaacgtggtccacaaa
atctattaccagaagaacgtgccggccatcatccccaagttcatcctgagggcggagtgc
attcagtttgagcgagacgtgaccatctggaacaacaagcagtacctgcccagaccgctg
ctggtctgcgaggacgccggcatccagaagcaccggcgctggtttgcgcagttctacagc
gagaggagcacgcggccatcagtgcccaaaggggacctggactggtga

DBGET integrated database retrieval system