KEGG   Gallus gallus (chicken): 427781
Entry
427781            CDS       T01006                                 

Symbol
Pou5f3
Name
(RefSeq) POU domain class 5 transcription factor 3 isoform 1
  KO
K09367  POU domain transcription factor, class 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    427781 (Pou5f3)
   03021 Transcription machinery [BR:gga03021]
    427781 (Pou5f3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    427781 (Pou5f3)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     427781 (Pou5f3)
SSDB
Motif
Pfam: Pou Homeodomain
Other DBs
NCBI-GeneID: 427781
NCBI-ProteinID: NP_001296301
CGNC: 53190
Ensembl: ENSGALG00000031482
UniProt: A7Y7W2
Position
17:complement(823420..826223)
AA seq 389 aa
MFSPDGGLPAAPFGLLPDGGPPFPRGGYDGAAAQQLFFPFASEPDGARDAATARAWLPPP
AGPPAKAEARPARPCRQGSPEPRAAPPATPCCGPAWAAPPWPGPAPPAATAVPGPPFPGP
AAAAFPAAPGHALCPAALQPSSGGLANLGSSGSSSGAASEGGHSSDSGDEDAPTSEELEQ
FAKDLKHKRIMLGFTQADVGLALGTLYGKMFSQTTICRFEALQLSFKNMCKLKPLLQRWL
NEAENTDNMQEMCNAEQVLAQARKRKRRTSIETNVKGTLESFFRKCVKPSPQEISQIAED
LNLDKDVVRVWFCNRRQKGKRLLLPFGNESEGVMYDMNQSLVPPGLPIPVTSQGYSLAPS
PPVYMPPFHKAEMFPPPLQPGISMNNSSH
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgttcagcccggacggggggctgccggccgccccattcggcctattgcccgacggcggc
ccgcccttcccgcgcggaggctacgacggcgcggccgcgcagcagctcttcttccccttc
gcctccgagcccgacggcgcccgcgacgccgcgacggcccgcgcctggctgccccctccc
gcggggccgcccgccaaggcggaggcgcgcccggcccggccgtgtcgccagggctccccc
gagccccgcgccgcgccgcccgccacgccctgctgcggccccgcgtgggccgcgccgccc
tggcccgggcccgcgccccccgccgccaccgctgtgcccggcccgccctttcccggcccc
gcggccgccgccttccccgccgcgcccggccacgcgctgtgccccgccgccctgcagccg
agctccggcggcctcgccaacctgggcagcagcggcagctccagcggcgcggccagcgag
ggcggccactccagcgacagcggagacgaggatgcgccaacctcagaggagctggagcag
tttgccaaggacctcaagcacaagcgcatcatgctgggcttcactcaggctgacgtgggg
ctggctctgggcacgctctatgggaagatgttcagccagaccaccatctgccgcttcgaa
gctctccagctcagctttaagaacatgtgcaagctgaagccactgctgcagcgttggctc
aatgaggcagagaacacggacaacatgcaggagatgtgcaatgcagagcaagtgctggcc
caagcccggaagagaaaacgcaggaccagcatcgagaccaacgtgaagggaacgctggag
agcttcttccgcaaatgtgtgaagcccagtccccaggagatctcccagatcgctgaggac
ctcaacctggacaaagacgttgtccgggtctggttctgcaaccggcgtcagaaaggcaag
cggctgctgctgccctttggcaacgagtcggagggggtgatgtacgacatgaaccagtcc
ctggtgccccctggtctgcccatcccagtgacatcccagggctacagcctggcgccgtcc
ccccccgtctacatgccacctttccacaaggccgagatgttccccccgcctctgcagccc
gggatctccatgaacaacagcagccactga

DBGET integrated database retrieval system