KEGG   Gallus gallus (chicken): 427808
Entry
427808            CDS       T01006                                 

Gene name
RAB11FIP4
Definition
(RefSeq) rab11 family-interacting protein 4 isoform X1
  KO
K12485  Rab11 family-interacting protein 3/4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    427808 (RAB11FIP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    427808 (RAB11FIP4)
Membrane trafficking [BR:gga04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    427808 (RAB11FIP4)
SSDB
Motif
Pfam: RBD-FIP bZIP_1 ZapB bZIP_2 TolA_bind_tri Shugoshin_N Leu_zip
Other DBs
NCBI-GeneID: 427808
NCBI-ProteinID: XP_004946223
CGNC: 2344
Ensembl: ENSGALG00000003227
Position
18
AA seq 572 aa
MRCEPHQHRTAQSQLRLRVPLSQGKGETWLLLTDWRPYTVLQRFPQLFSGGEIQDCAYLD
SEGIYSESELFPDEDAMTLAQQEVHHESDMDSAIESAQSSEASDVCRSEEKDGMLGVLFL
SGDKASPHNPSAASDLSTYSTTSLISNEEQFEDYGEGDDVDFTPSSPCPDDETRTNAYSD
LGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPNRKISS
TAFGRQLFHNSNFSSSNGSTEDLFRDSIDSCDNDITEKVTYLEKKVTELENDNLTNGDLK
SKLKQENTQLVHRVHELEELLKDQETSAEQTLEEEIKRHREAYSKYEKEKGTEIELLNTR
VQQLEEENGELKSTVMRLKSQTERLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQN
RLEFNKEREATQELIEDLRKELEHLQLYKLECERPGRGRSSSSSVSEFNAKTREVEMEHE
IKRLKQENQKLRDQNDDLNGQILSLSIYEAKNLFATQTKAQSLAAEIDSASRDELMEALK
EQEEINYRLRQYMDKIILAILDHNPSILEIKN
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgcgctgtgagcctcatcagcaccgcacagcgcagtcccagctccggcttcgcgtccct
ctgagccaaggcaagggagaaacgtggctgctgctcacagactggagaccctacactgtc
ctgcagagatttccacagctcttctcaggtggtgaaatccaggactgtgcctacttggac
agcgaaggcatctacagcgagtcggagctcttccctgatgaggacgcaatgactctagca
cagcaggaggttcaccatgagtccgacatggacagtgctattgagagtgcccagagctca
gaggcctctgatgtgtgtcggagcgaggagaaggatggcatgcttggtgtcctgtttctg
tctggtgacaaggcaagtcctcacaacccttctgcagcatctgacctctccacttattcc
accacctcactgatcagtaatgaagagcagtttgaagactatggggaaggagatgatgtg
gattttactcccagtagcccctgtcctgatgatgagaccagaacgaacgcctactctgac
cttggctcatctgtatcttccagtgctggccaaacaccccgaaaaatgaggcatgtttat
aacagcgagttactggatgtttactgctcacagtgctgcaaaaagataaatctactcaac
gatttggaagccaggctgaaaaacttgaaagcaaacagccctaacaggaaaatatcaagc
acagcctttggaaggcagctcttccacaatagcaacttcagcagcagtaatggcagcaca
gaagacctcttcagagacagtatagactcctgtgataatgatataactgaaaaggtaaca
tacctagaaaaaaaggttacagaattggaaaatgataacctgactaatggtgacctaaag
agcaaactgaaacaagagaacacgcagttggttcacagagttcatgagctggaagagcta
ttgaaagaccaggagacatcagcagaacaaaccctggaagaagagataaagagacatcga
gaagcttatagcaagtatgaaaaagagaaaggcaccgaaattgaactgctaaatacaagg
gttcagcaactggaagaagagaatggtgagctgaaaagcactgtcatgcgactgaaatca
caaacggagagattagatgaggaaaggcaacgcatgtcagataggttggaggacaccagt
ctgcgactgaaggatgagatggatttgtacaagagaatgatggacaaactgcgacagaac
agactggaatttaacaaagagagggaagccacacaggagcttattgaggacttgcgaaag
gaactggagcacttgcagctctacaagctggaatgcgagcgtcctggacgtgggagaagt
tcctcatccagcgtgagtgaattcaatgctaaaaccagagaggtggaaatggagcatgaa
ataaaacggctgaagcaggagaatcagaaacttcgtgaccaaaatgatgatcttaatgga
cagattcttagtttgagtatctacgaagctaaaaatctctttgcaacacaaacaaaagcc
cagtcactggctgctgagattgactctgcatcaagagatgagctcatggaagcccttaaa
gaacaggaggagatcaattacagattgcgacagtatatggacaagatcattttggcaatc
ctagatcacaacccatctatcttggaaataaagaattga

DBGET integrated database retrieval system