KEGG   Gallus gallus (chicken): 427838Help
Entry
427838            CDS       T01006                                 

Gene name
HNF1B
Definition
(RefSeq) hepatocyte nuclear factor 1-beta isoform X1
  KO
K08034  transcription factor 2, hepatocyte nuclear factor 1-beta
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    427838 (HNF1B)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, HNF1
    427838 (HNF1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNF-1B_C HNF-1_N Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 427838
NCBI-ProteinID: XP_003642461
CGNC: 4099
Ensembl: ENSGALG00000005504
Position
19
AA seq 557 aa AA seqDB search
MVSQLSALQRELLGALLSSGATKEGLIRALEDMVPAAGFGVKLESLPLSPGGPPDGKPGF
VPLANGHGKGKLSGDEGSEDGDDFDTPQILRELQALNTEEAVEQRAEVDRMISEDPWRAA
KMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQ
FNQTVQGCENRTDKSSQDQLLFLFPEFNQQNQGAGQLDDACAETPSKKMRRNRFKWGPAS
QQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFAN
RRKEEAFRQKLAMDAYSSGQPTHSMNLLLSHGSPHHNQPSASPPSKMPGVRYGQGASSEA
ASSGAISHHGSGAMVTTSQAVLQQVSPAGLDPGHGLLSPDGKMISVSGGGLPPVSTLTNI
HSLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQSVPVINSVAGSLAALQPVQFSQQLH
SPHQQPLMQQSPSHMAQQPFMATVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSI
STLTNMSSSKQCPLQAW
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcccagctgagcgccctgcagcgggagctcctgggcgccctgctcagctccggg
gccaccaaggaggggctgatccgcgccctggaggacatggtgcccgccgcaggcttcggc
gtcaagctggagagcctgccgctgtcccccggcgggccgcccgacggcaagcccggcttc
gtgccgctggccaacgggcacggcaagggcaagctgtccggcgacgagggctcggaggac
ggcgacgacttcgacacgccgcagattctccgcgagctgcaggcgctcaacactgaggag
gccgtggagcagcgggcagaagtggacaggatgatcagcgaggacccatggcgggcggcg
aagatgatcaagggctacatgcagcagcacaacatcccgcagcgcgaggtggtggacgtc
accggcctcaaccagtcgcacctctcgcagcacctcaacaaaggcacccccatgaagaca
cagaagcgggccgccctctacacgtggtacgtccgcaagcagcgggagatcctgcggcag
ttcaaccagacagtccaggggtgtgaaaataggacagacaaaagcagtcaggatcagctg
ctgtttctctttccagagttcaatcagcagaaccagggggctggccagctcgacgatgcc
tgcgccgaaacccccagcaagaagatgcgccgcaaccgcttcaagtgggggccggcctcc
cagcaaatcttgtaccaagcctacgaccgccaaaagaaccccagtaaggaggagcgggag
gcgctggtggaggagtgcaacagggccgagtgtctgcagcgaggggtgtccccctccaag
gcgcatggtcttggctccaacctggtgacggaggtgcgtgtctacaactggttcgccaac
cggcggaaggaggaagctttccgccagaagttggccatggacgcctacagctcaggccag
cccacgcacagcatgaacctgctgctgtcccacggctccccgcaccacaaccagcccagc
gcctcaccgcccagcaagatgccaggggtccggtacggccagggggcgagcagcgaggcg
gcatcctccggggccatcagccaccacggcagcggtgccatggtcaccaccagccaggcg
gtcctgcagcaggtctccccagccggcttggacccgggccacggtttgctctctcccgac
ggtaaaatgatctctgtgtcgggtggtgggctgccgccagtgagcaccctgaccaacatc
cacagcctgtcccaccacaacccgcagcagtcccagaacctcatcatgacgccgctctca
ggagtcatggccattgcacagagtctgaacacctcgcaggcacagagcgtccctgtcatc
aacagcgtggctggcagcttggcagccctgcagccggtgcagttctcgcagcagctgcac
agcccacaccagcagccactcatgcagcagtcgcccagccacatggcccagcagcccttc
atggccaccgtcacccagctgcagaactcgcacatgtatgcacacaagcaggagcccccc
cagtattcccacacctcccgcttcccctcggcaatggtggtgacagacaccagcagcatc
agcacactcaccaacatgtcttccagcaagcagtgtcccctgcaagcctggtga

DBGET integrated database retrieval system