KEGG   Gallus gallus (chicken): 427840
Entry
427840            CDS       T01006                                 

Gene name
MNT
Definition
(RefSeq) max-binding protein MNT isoform X1
  KO
K09115  MAX-binding protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    427840 (MNT)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    427840 (MNT)
SSDB
Motif
Pfam: HLH TFIIA Sipho_Gp157
Other DBs
NCBI-GeneID: 427840
NCBI-ProteinID: XP_015151356
CGNC: 4352
Ensembl: ENSGALG00000005830
Position
19
AA seq 572 aa
MGICNACAKELRGDWRRTEDRSCAAHIPQQLLAPEEDEKHEKLRLEREQEQRKASVPRAN
HAVPPEEPRGELLVPISPPAPAPPPPPPLAAPISVIPIPVVTSPPQPAAQAALSPPLAQR
HPPLVSTPGITKEPSSVAPVIQRPPGTLLPDGKASTPPAGSPKQLQHYAAPVLAISQHHV
VPQPIQPQPMPHPAPPLGALKLAPAEDVKPSEQKKRPGGVGTREVHNKLEKNRRAHLKEC
FETLKRNIPNVDDKKTSNLSVLRSALRYIQTLKRKEKEYEHEMERLAREKIATQQRLAEL
KNELSQWMDIMEIDRIVRQTVQPEDDQASTSTASEGEDNMDEDMEDDRPVNSLPKLAQRQ
HPELLKAVPSNAASHHLAVLPQHLSIQQKQPPAHAQPSIQTQALVQPQAIVPAQTHIVAA
STVQSTVIAHTATTHASVIQTVNHVIQGPQTKHIAHIAPSTSSPVQLTTAAQPIGHITVH
PATINHMAHLGQQLPIYPQPVAVSQPVVSHIAHTISHQQVNGTTSLGQQAVMAKPAVGTQ
VVHHPQLVGQTVLNPVTMVTMPSFPVSTLKLA
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggggatttgtaatgcatgtgccaaggagctgcggggtgactggaggagaacggaggac
cggagctgtgcagcacacatcccccagcagctgctggcaccagaagaggatgagaagcac
gagaagctccgcctggagcgggagcaggagcagcggaaggccagtgtgccgcgggccaac
catgccgtccccccagaggagccacggggtgagctgctggtgcccatctcgccgcctgcc
ccggcccctccaccacctccgccgctggcggcccccatctcagtcatccccatcccggtg
gttaccagcccgccgcagcccgctgcccaggccgccctgtccccgccgctggctcagcgc
catccgcccctcgtgagcactcccggcatcaccaaggagccgtcctccgtggccccggtc
atccagcggccgccgggcacgctgctgccggacgggaaggcgagcacaccgcctgcgggc
agcccgaagcagctgcagcactacgcggcgcccgtcctggccatctcgcagcaccatgtg
gtcccgcagcccatccagccccagcccatgcctcacccggcccctccactcggtgccctg
aagctggctccagcagaggatgtgaaacccagcgagcagaagaagaggcctggaggggtt
gggaccagggaagtacataataaattggagaaaaacagacgtgcacatttgaaagaatgc
tttgagacattaaaacgcaacatccccaacgtagacgacaagaagacctcaaacctcagc
gtcctaaggagtgccttgcgatacatccagactttaaagagaaaggaaaaagaatatgag
catgagatggagcggctggcaagggagaagatcgctacccagcagcggctggcagagctg
aagaacgagttgagccagtggatggacatcatggagattgacaggattgttcgacagaca
gtacagccagaggatgaccaggcatctacctccacagcgtcagagggtgaagacaacatg
gatgaagacatggaagatgacaggcctgtgaactcattaccaaaactagcccagcgccag
cacccagagctcctgaaagccgtcccttcaaacgctgcttcccatcacctggcggttttg
cctcagcacctgtctatccagcagaaacagcccccagcccacgcacagccttccatccag
acacaagcactggtgcagccgcaggcgattgtcccagcacagactcacatcgtggcggct
tcgacagtgcaatcgactgttattgcccacaccgccactacccacgcttcggtcattcag
actgtcaaccacgtcattcagggtccacagaccaagcacattgctcacattgcaccttcc
acgtccagccctgtgcaacttaccactgctgctcagcctatcggccacatcactgtgcac
ccagccaccatcaaccacatggcccacctcggccagcagctgcccatctaccctcagccc
gtggctgtcagccagcccgtggtgagccacatcgctcacacgatctctcaccagcaagtg
aatggaaccacaagtcttggccagcaagcggtgatggccaagccggccgtaggaacccaa
gttgtccatcacccacagttagtcgggcaaacggtcctaaatccagtaactatggtaacc
atgccatcattcccagtgagcacactgaagctggcctag

DBGET integrated database retrieval system