KEGG   Gallus gallus (chicken): 427871
Entry
427871            CDS       T01006                                 

Gene name
ALX1
Definition
(RefSeq) ALX homeobox protein 1
  KO
K09334  cartilage homeoprotein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    427871 (ALX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    427871 (ALX1)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 427871
NCBI-ProteinID: XP_025010336
CGNC: 8462
Ensembl: ENSGALG00000027213
Position
1
AA seq 328 aa
MIMDFLSEKFALKSQPSKNSDFYMGAGGTLEHVMETLDNESFYSKTSGSKCVQAFNPLQR
AEHHVRLDRTSPCQDNNVNYGITKVEGQPLHTELNRPLDNCNNLRMSPVKGMQEKGELDE
LGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQV
WFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNTASGSVVTS
CMIPRDTSSCMTPYSHSPRTDSGYTGFSNHQNQFSHVPLNNFFTDSLLSGATNGHAFETK
PEFERRSSSIAVLRMKAKEHAANISWAM
NT seq 987 nt   +upstreamnt  +downstreamnt
atgattatggattttctgagtgagaagtttgccctgaagagccagccgagcaagaacagt
gacttttacatgggagcaggaggcactttggagcacgttatggaaactttggacaatgag
tccttttatagcaaaacgtcaggcagcaaatgtgtgcaggccttcaaccctctgcaaagg
gctgagcatcatgtgaggctggacaggacatcaccctgccaagacaacaacgtgaactat
gggattactaaagtggaaggacagcctcttcacacagagctcaacaggcccttggacaac
tgcaacaatctgaggatgtctccggtgaaggggatgcaggagaagggggaactggatgaa
ctgggtgataagtgtgacagcaatgtctccagcagtaagaagaggagacacagaacaact
ttcaccagtttgcagctggaggaactggagaaagtcttccagaaaactcattaccctgat
gtctacgtgagggagcagctagctctgaggacagagctcaccgaggccagagtccaggtt
tggttccagaatagaagagcaaaatggaggaaaagagaacgctatgggcagatccagcaa
gctaagagccattttgctgccacttatgatatatctgttcttccaaggactgacagctat
cctcagattcagaacaatctgtgggcggggaacaccgctagtggttctgtggttacttcc
tgcatgataccacgagatacttcctcctgtatgacaccttattcccattcaccccggaca
gattctggctacacaggcttttcaaaccaccagaatcagttcagccatgtgcctctcaat
aattttttcactgactctttactttctggggcaaccaatggacatgcttttgaaaccaag
ccggaatttgaaaggagatcttccagcattgcagttctacggatgaaagccaaagagcat
gctgccaatatttcctgggctatgtaa

DBGET integrated database retrieval system