KEGG   Gallus gallus (chicken): 427879Help
Entry
427879            CDS       T01006                                 

Gene name
ART4
Definition
(RefSeq) ecto-ADP-ribosyltransferase 4 precursor
  KO
K06717  ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     427879 (ART4)
CD molecules [BR:gga04090]
 Proteins
  427879 (ART4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
 Enzymes
  427879 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ART ADPrib_exo_Tox
Motif
Other DBs
NCBI-GeneID: 427879
NCBI-ProteinID: NP_001135727
CGNC: 8923
Ensembl: ENSGALG00000011742
UniProt: B6RDJ8
Position
1
AA seq 289 aa AA seqDB search
MSVLLLASILLLILQRLAGSHLMMDMALHSFDDQYLGCREQMMEELERGDYFQKEIAANK
NYSSLWKKAQEALLKSSVGLLREMHDSHATALMAYTMNSSLHSQLNWATSTAGRSPEQYR
HNFSFKYFHFYLTTAIQIMKQWQSSKDNVRKRHCYRVHRGVKDLYIKATVGSIVRFGRFT
STSCLWNEAQKFGNETLFTVTTCLGAAMQGFSYYTSEKEVLIPPYEIFLVKNFFRTRRGN
RLHLHSVGNYSKYHYQLLEASRIKNGGSTASAAIILPSVIGVFLCLAKQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgcttctgctggccagcattctgttgctgatcttgcaaagactggcagggtcc
caccttatgatggatatggctctacattcctttgatgaccagtacctgggttgcagagag
cagatgatggaagaactggagcggggagactatttccagaaggaaatagctgctaataag
aactattcgagcctctggaagaaggctcaggaagctttgttgaagagctctgtaggtctc
ctgagggagatgcatgacagtcatgccaccgccctcatggcttacaccatgaattcttcc
ctgcactctcagctgaattgggccacatccacagcaggaaggtctccagagcaatacaga
cacaacttcagcttcaaatattttcacttttacctaacgacagccatccagataatgaag
caatggcagagcagcaaggacaacgtaaggaaacgccactgctaccgggtgcacagaggt
gtaaaggacttatatattaaggctacagttggcagcatagtgcgatttggccgtttcacc
tccacctcttgcctctggaatgaagcccagaaatttgggaatgaaactttgtttacggtg
acaacctgcctgggagcagctatgcaaggcttttcttactacacgtctgagaaggaagtc
ctcattcccccttatgagatattccttgtcaaaaacttctttcggacacggcgtggtaac
cggctgcacctgcattctgtggggaactacagcaagtaccactaccagctcttggaagct
tcaagaatcaagaacggtggttctactgcctctgccgccatcattcttcctagtgtaatt
ggtgttttcttgtgcttggccaagcaatga

DBGET integrated database retrieval system