KEGG   Gallus gallus (chicken): 427898
Entry
427898            CDS       T01006                                 

Gene name
FAM109B
Definition
(RefSeq) sesquipedalian-2
  KO
K23791  sesquipedalian
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    427898 (FAM109B)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    427898 (FAM109B)
Membrane trafficking [BR:gga04131]
 Protein recycling
  Others
   Others
    427898 (FAM109B)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   427898 (FAM109B)
SSDB
Motif
Pfam: PH PH_8 PH_11 ASCH
Other DBs
NCBI-GeneID: 427898
NCBI-ProteinID: XP_425472
CGNC: 9020
Ensembl: ENSGALG00000011898
Position
1
AA seq 251 aa
MKLNERSVAHYATCDSPTDHAGFLRKRVERHHHHGHHGTSYQRRWFVLKGNLLFYFEERE
SREPVGLVVLEGCTVELCEAAEEFAFAIRFDDAGAKAYVLVADGQAAMEAWVKALSRASF
DYMRLVVRELEKQLEEACTSLAACRKSPRKSSSGRRRHLSNPALPPVQEKQHVLENGYST
WGSDPDRDGGHTKPPPLPPRRRSAAGSSAPALQESPVSPETTCFAKLHHWYGQEIAALRQ
EWQERQKRGHP
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaagctgaatgagcggagcgtggcccactacgccacctgtgactctcccactgaccac
gccggcttcctccgcaagcgtgtggagcggcaccaccaccatggccaccacggcacctcc
taccagcgccgatggtttgtcctcaagggcaacctcctcttctactttgaggagcgggag
agccgggagcccgtggggctggtggtgctggagggctgcaccgtggagctctgcgaggct
gccgaggaattcgcctttgccatccgctttgacgatgctggcgccaaggcctacgtgctg
gtggctgacgggcaagctgccatggaggcctgggtgaaggcgctctcacgggccagcttc
gactacatgcggctggtggtgcgggagctggagaagcagctggaggaggcctgcaccagc
ttggctgcatgccgcaagtcaccacggaagtcctcctcaggcaggagacgtcacctctcc
aaccctgccctgccgcctgtccaggagaaacagcatgtcctggagaatgggtactccacg
tggggcagcgaccctgaccgcgatggggggcacacaaagcccccacccctgcctccacgc
cgacgctcagccgcagggtcctcagcgcccgccttgcaggagagcccggtgtcaccagag
acaacctgctttgccaagctgcaccactggtacgggcaggagatcgcggcgctgaggcag
gagtggcaggagaggcagaagaggggacacccatga

DBGET integrated database retrieval system