KEGG   Gallus gallus (chicken): 427912Help
Entry
427912            CDS       T01006                                 

Gene name
ASCL4
Definition
(RefSeq) achaete-scute homolog 4
  KO
K09067  achaete-scute complex protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    427912 (ASCL4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Achaete-Scute
    427912 (ASCL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 427912
NCBI-ProteinID: XP_004937863
CGNC: 13824
Position
1
AA seq 188 aa AA seqDB search
MASNNDDDGLLNRIAFAGAMPLANSHIRPHGVPLREPFGVPIHLDPSYWERAYGGHAGRI
SYVPFPGYVGVYDYSFEPAFIRKRNERERQRVRCVNEGYTRLREHLPKEFADKRLSKVET
LRAAINYIKHLQSLLDCHPLGSNNKDSLTTKELPDAPSPGPLRECNSDGESKASSASSPY
SEFEEVGS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaataacgatgatgatggactgttgaacaggattgcatttgcaggagcgatg
cccctggctaacagccacatccgtccccacggggttcccctgagagaacccttcggggtt
cccatccacctcgacccgtcgtactgggagcgagcctatggtgggcatgcaggtcgcatc
tcctacgtcccattccctggctacgtgggcgtctacgactattcctttgagcctgccttc
attcggaagaggaacgagagggaaaggcagcgggtgcgctgcgtgaatgagggctacaca
cgcctgagagagcacctgcccaaggaatttgctgacaagcgcctcagcaaagtggagacc
ctgagagcggccataaactacatcaagcacctgcaaagcttgctggactgccatcccctg
gggtctaacaataaggattcgctcaccaccaaggagctcccagatgctcccagccccggt
cctctgcgggaatgcaacagtgatggagagtcgaaagcctcctcagcctcatccccctac
agtgaatttgaggaggtgggtagctag

DBGET integrated database retrieval system