KEGG   Gallus gallus (chicken): 427967Help
Entry
427967            CDS       T01006                                 

Gene name
TMPRSS15
Definition
(RefSeq) enteropeptidase
  KO
K01316  enterokinase [EC:3.4.21.9]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    427967 (TMPRSS15)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.9  enteropeptidase
     427967 (TMPRSS15)
Peptidases and inhibitors [BR:gga01002]
 Serine peptidases
  Family S1: chymotrypsin family
   427967 (TMPRSS15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB MAM Ldl_recept_a SEA SRCR_2 DUF1986 SRCR CUB_2 Raco_middle Trypsin_2 Hepsin-SRCR
Motif
Other DBs
NCBI-GeneID: 427967
NCBI-ProteinID: XP_015154388
CGNC: 11732
Ensembl: ENSGALG00000015730
Position
1
AA seq 1060 aa AA seqDB search
MKLRKSSREKHVPLSYYEILFVSLLALFVCVCVGLTVLSWLAIKDLEQAQTAGNSQGYMG
TFKIISGTSFIPALQDKSSDDFKVLAFDVEHLIQEIFQASDLTNKFKRCEIFQFKNPEEG
NENFKTSQTGVVVIFGLYLNQRETDEKIKNELLSGINANATDLSQTLKIDVNSIQITVVA
ENPTTTMLPLISSDPVSLITNSLASTPEQLTTIKAATTSVECSPPAEVCDDGVTCIRKDL
FCDGILDCPDGSDELEKRCAVICDGKFMLTDSSGSFHSMNYPKPYNANIVCQWIIRVPQG
LSIKVNFTSFDTEQFMDNLNIFEGVGQNKTLRASLSGYNPETVHIFSHEVTARFTSDYSE
NCNGFNATYTAFNASELKNSERVNCTFEDGFCYWIRDLDDDLDWERYQGPTFPFMSGPDF
DHTFGNMSGFYISTPTGLGVEEGRVRIQSLPLISSDPSCLSFWYYMYSPNIYRLCVSIRS
EYGLEKIILQKEGNYGKSWIYGQVTLNETSDFKVIFDAFTRIAPSEIALDDISLTEGKCN
ESNYVEPTAFPIATTTASVPTDCGGPVELWEPNSTFSSENFPNNYPNQASCIWYLNAEKG
KNIQLHFQVFDLENIYDVVEVRDGRGQDSLLLAVYTGNDPLPDVFSTTNQMTVTLSTDKF
STSKGFLANFTTGYHLGACAPEEYQCQSGHCIPLDNLCDKVPQCEDGSDEAKCMRLLNGS
ASTEGLVQVRIGKAWHLACADDWNEKISDSVCQQLGLGNSNMSSTVSFTGEGPFASIAEV
ANHSLIFTKKEHCLNNLVIHLQCNIKPCGKRLEIENKGTRIVGGSDARREAWPWIVSLHF
NSRPVCGASLVNEEWLVTAAHCVYGRQLQPSTWKAVLGLYDQSNMTDASTVVRNIDQIVI
NPHYNKVTKDSDIALMHLQYEVQYTDYIQPICLPEKNQQFLPGINCSIAGWGAIRYEGPT
SNILQEAVVPLISNEKCQEWLPEYSISKNMICAGYDMGGVDSCQGDSGGPLMSEDGNQWV
LVGVTSFGYECALAQRPGVYVRVAMFVDWIQKIIYYLDIP
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgagaaaatcatctcgtgagaaacatgttcctcttagttactatgaaattttg
tttgtttctctgcttgcactttttgtgtgtgtctgtgtggggctgactgtactttcatgg
ttagcaatcaaggacttagaacaagctcaaactgctggaaatagtcaaggctacatggga
acatttaaaataatttctgggacatcattcattcctgctttgcaagataaatcatcagac
gacttcaaagtccttgcctttgatgttgaacacttgatacaagaaatctttcaagcaagt
gatctgacaaataaatttaagagatgtgaaattttccagttcaagaaccctgaagaaggt
aatgaaaacttcaagacatctcaaacaggtgttgttgtgatcttcggcctttatcttaac
cagagagaaacagatgagaaaataaaaaatgagttactttcagggatcaacgcaaatgca
actgatctttctcagaccttgaaaattgatgtgaacagcatacagatcacagtggttgct
gagaatcctactactacaatgttgcctttaatttcctcagatcctgtgagtctaattaca
aattctctggcatcaactccagaacaactgacaacaatcaaggctgcaacaacttcagtt
gagtgttcaccgcctgctgaagtttgtgatgatggagtaacctgcattagaaaggattta
ttttgtgatggaatcctggactgcccagatggttcagatgaattggaaaaaagatgtgct
gtgatttgtgatggaaaattcatgctgaccgattcctctgggtcttttcactctatgaat
tatccaaaaccgtataatgcaaatattgtttgccagtggattatacgagtgcctcaaggg
ttatccattaaggtgaacttcacttcttttgatacagaacagtttatggacaatttaaat
atttttgaaggtgtaggacaaaacaagactttaagagcttctctctcaggatataatcct
gagacagttcacattttttctcatgaggttacagccaggtttacgtctgattattctgaa
aactgcaatggttttaatgcaacatacactgctttcaatgcaagtgaactaaaaaattct
gagagagtcaattgcactttcgaagacggcttttgttactggatacgagatttagatgat
gatttagactgggaaagatatcagggccctacctttccctttatgagtggtcctgatttt
gatcatacatttggcaatatgtcaggattctatatttcaacacccacaggacttggagtt
gaagaaggaagagttcgaattcagagtttgcctttgatctcttcagatccatcttgccta
agtttttggtattacatgtacagtcctaacatttaccgtttatgtgttagtataagaagt
gaatatggtctggaaaagataattttacagaaagaaggaaactatggaaaaagctggata
tatggacaagtaactttaaacgaaacatctgattttaaggttatatttgatgcctttaca
aggattgctccaagtgagattgccttagatgatattagcctgacagagggaaagtgtaat
gaaagcaattatgtagagccaactgcatttccaattgccactactactgcttcagttccc
actgactgtggaggtccagttgaactctgggagccaaacagtacattcagctctgaaaat
tttccaaacaattatcctaatcaagcctcttgtatatggtacttaaatgccgaaaaagga
aaaaacattcaacttcactttcaggtttttgatctggaaaatatttatgatgtagttgaa
gtcagggacggcagaggacaagattccttacttttggctgtctatacaggaaatgaccca
ctgcctgatgtcttctctacaacaaatcaaatgacagtaactctttctacggacaagttt
tcaacaagtaagggatttcttgcaaactttactactgggtaccatctaggagcttgtgca
cctgaagaatatcagtgtcagagtggacactgcataccattggataacctttgtgataag
gtacctcaatgtgaagatggctctgatgaagcaaagtgcatgagattgcttaatggctct
gcaagcactgaaggactggtacaggtcaggattgggaaggcatggcacctggcatgtgca
gatgattggaatgaaaagatttcagacagtgtttgccagcagctgggattggggaattca
aatatgtcatcaactgtatcattcactggagaaggtccatttgccagcatcgctgaagta
gctaatcacagcctaatatttacaaaaaaagaacattgtttaaacaacctggtgattcat
ctgcagtgtaacattaaaccttgtggaaaacgcctggaaattgagaacaaaggaacaagg
attgtaggtggaagtgatgccagaagagaggcttggccttggattgtctcacttcatttt
aattccagacctgtttgtggagcctcccttgtcaatgaggaatggctggtgacagcagca
cactgtgtatatgggagacaattacaaccatctacatggaaagcggttcttggcttgtat
gaccagtcgaatatgacagacgcttcaacggtagttcgaaacattgatcaaatagttata
aatcctcattataacaaagtcacaaaagacagtgatattgctctgatgcatctccaatac
gaagttcaatatacagattacatacaacctatctgcttaccagaaaaaaatcaacagttt
ctaccaggaattaactgctccattgctggctggggtgctattagatatgaaggtcccact
tcaaatatattgcaagaagcagtggtccctctcatttcaaatgaaaaatgccaggaatgg
ttgccagaatacagtatttctaagaatatgatctgtgcaggctatgacatgggaggagtt
gattcctgtcagggagattcaggaggccctctcatgtctgaagatggcaaccaatgggtt
ttggtaggtgtaacatcatttggctatgagtgtgcacttgcccaacgaccaggagtgtat
gttcgggttgctatgtttgtggactggatccaaaaaatcatctattacctcgatattcct
taa

DBGET integrated database retrieval system