KEGG   Gallus gallus (chicken): 428015
Entry
428015            CDS       T01006                                 

Gene name
EDAR
Definition
(RefSeq) tumor necrosis factor receptor superfamily member EDAR precursor
  KO
K05162  tumor necrosis factor receptor superfamily member EDAR
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    428015 (EDAR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:gga04050]
    428015 (EDAR)
Cytokine receptors [BR:gga04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   428015 (EDAR)
SSDB
Motif
Pfam: SpoIIIAH Wzy_C_2 TNFR_c6 OAD_gamma
Other DBs
NCBI-GeneID: 428015
NCBI-ProteinID: NP_001012629
CGNC: 12611
Ensembl: ENSGALG00000016809
UniProt: Q5EFZ7
Position
1
AA seq 448 aa
MAHLGECKWTHVFPFLVVSLVYSASAEYSNCGENEYYNQTTGMCHDCPKCEPGEEPYMTC
GYGTKDEDYGCIPCPSEKFSRGGYQICRRHKDCEGFFRATVLTPGDQENDAECGPCLPGY
YMLENRPRNIYGMVCYSCLLAPPNTKECAGATSGISAIFPSTSGTSTFSPYQHAHKADLS
GQGHLATALIIAMSTIFIMAIAIVLIIMFYIVKTKPSAQACCKSHSVKNVEAQANTQEEK
KEVQDNVVIFSEKEEFEKLTATPAKAAKSENDASSENERLLSRSMDSDEEAAVDKQGTPE
RCLLSLVHLARDKSSTSNKSTGIQSRRKKILDVYANVCDVAEGLSPTELPFDCLEKTSRM
LSSTYNTEKAIVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIE
RLDAVESLCADILEWAQAMPAPEPAVTS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggctcacctgggtgaatgtaaatggactcatgtgttcccttttctggtggtttccttg
gtgtactctgccagcgctgaatactccaactgcggtgagaacgaatactacaaccaaacc
actggcatgtgccacgactgccccaaatgtgagccgggtgaagagccgtacatgacatgt
gggtatggcaccaaagatgaggactatggctgcattccctgcccatcagagaagttttcc
agaggaggttaccagatatgcaggaggcacaaggactgcgagggattctttcgagccact
gtcctgacaccaggcgatcaagagaacgatgcagagtgcgggccttgtctcccaggttac
tacatgctggaaaacagacctcgaaacatatacggaatggtttgctactcatgcttgttg
gcacctcctaacaccaaagaatgtgcaggggctacctctggcatttcagccattttcccg
agcacgtctggcacaagtactttctcaccttaccagcatgctcacaaagcagacctttca
ggacaaggacatctggctacagctctgataattgcaatgtctaccatattcataatggct
attgccattgtcctcatcatcatgttttacattgtgaaaaccaaaccttctgctcaagcc
tgttgcaagagtcactcagtaaaaaatgtcgaagctcaggctaatactcaagaagagaag
aaagaagtacaagataatgttgtgatattctctgagaaagaagagtttgaaaaacttaca
gcaactccagctaaggctgctaaaagtgaaaacgatgcatcttctgagaatgaacgactt
ctaagtcgtagcatggatagtgatgaagaagctgcagttgacaagcaagggacaccagag
agatgcttgttatcattagtgcatttggccagagataaatcttccacaagcaataaatca
actgggattcaaagtcgaagaaagaagatacttgatgtgtacgctaacgtgtgcgacgtt
gcagaaggcctgagccctacggagctgccttttgactgtctggagaagaccagccgaatg
ctcagttcaacatacaatactgagaaggccatagtgaaaacgtggcgtcaccttgctgag
agctttgggctgaagagggacgaaattggtggcatgacagatggcatgcagctgtttgac
cgcatcagcacagcgggctacagcatcccggaactgctcaccaaactggtacaaatcgag
cggttggatgctgtcgagtctctgtgtgcagatattctggagtgggcacaagcaatgcct
gctcctgaaccagcagtgacgtcctga

DBGET integrated database retrieval system