KEGG   Gallus gallus (chicken): 428095
Entry
428095            CDS       T01006                                 

Gene name
RAB38
Definition
(RefSeq) ras-related protein Rab-38
  KO
K07923  Ras-related protein Rab-38
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    428095 (RAB38)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:gga04031]
    428095 (RAB38)
Membrane trafficking [BR:gga04131]
 Others
  Rab GTPases of specific organelles
   Melanosome
    428095 (RAB38)
GTP-binding proteins [BR:gga04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab29/32/38 [OT]
    428095 (RAB38)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA TniB MMR_HSR1 AAA_7 AAA_22 TsaE PduV-EutP
Other DBs
NCBI-GeneID: 428095
NCBI-ProteinID: XP_015135839
CGNC: 66547
Ensembl: ENSGALG00000028018
UniProt: R4GLM3
Position
1
AA seq 265 aa
MLSPRLNISLNTSRPTAILDGDLDSAYEELTVPGIPGAEHAISSQGAASATGKMQKHNQK
EHLYKLLVIGDLGVGKTSIIKRYVHQNFSPHYRATIGVDFALKVLSWDAETVVRLQLWDI
AGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVTKWKEDLDSKLVLPNGKPVPTVLLA
NKCDQGIDVLMNNGIKMDQFCKENGFVGWFETSAKENININEASRCLVKHIIATESDPVQ
PIETDIIKPHLNSGKIVSCSACFKS
NT seq 798 nt   +upstreamnt  +downstreamnt
atgctcagtccacgtctgaacatctcactgaacacctcacgccctaccgccatcctcgat
ggtgaccttgattcagcctatgaggagctcactgtaccagggattcctggggcagagcat
gcaatcagttcgcagggagcagcctcagcgacaggaaagatgcagaagcacaaccagaag
gagcacctctacaagctgctggtgatcggggacctgggagtgggcaaaactagcatcatc
aagcgctatgtccaccagaacttctccccccactaccgggccaccattggggtggacttt
gccttgaaggtcctcagttgggatgctgagactgtggtacggctgcagctctgggatatt
gcgggtcaggaaagatttggaaacatgaccagggtctattacagagaggccatgggagca
tttattgtctttgatgttacaagacctgcaacattcgaagctgtgacaaaatggaaagaa
gatttggactctaagcttgttcttccaaatggcaaacctgtaccgacagtcctcttagca
aacaaatgtgaccagggaatagacgttcttatgaacaatggcatcaagatggatcagttc
tgcaaggaaaatgggtttgtgggctggtttgaaacatcagccaaggaaaatataaacatc
aatgaagcttccagatgcttggtgaaacacataattgctactgagagtgatccagttcag
cctattgaaacagatattataaaaccacacttgaattctggcaagattgtcagttgttca
gcttgctttaaatcctaa

DBGET integrated database retrieval system