KEGG   Gallus gallus (chicken): 428104Help
Entry
428104            CDS       T01006                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    428104 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    428104 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    428104 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    428104 (FGF23)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   428104 (FGF23)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   428104 (FGF23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 428104
NCBI-ProteinID: XP_425663
CGNC: 66548
Ensembl: ENSGALG00000027791
UniProt: R4GIR0
Position
1
AA seq 254 aa AA seqDB search
MPHTSPCSCLEYMLLVLCILKAAVAFPNSSPLLNPSWGNGDQLMHLYTSTERNSFHLQIN
ADGHINGVPHQTIYSALMIKSEGAGCVIITGVKSGRYLCMDMKGDIFGSYYFSQEDCVFN
QRTLENGYDVYQSPKHNFLVSLGRTKQVFFPGMNPPPYSQFLSRRNEIPLFRFNTPEPHR
NTRSADVDPLDPHQILVPQRKVSALGSQLQLQMDFSHVPREPMRVNQNDVVNPDDPHAMM
DARRYASPRFYITR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccacacaccagtccctgcagctgcctggagtacatgctgcttgtgctctgtatcctg
aaggctgcagtcgccttccccaactcctctccgctgctgaatcccagctgggggaatgga
gatcagctgatgcacttgtacacttctacagagaggaacagcttccatctccaaatcaat
gctgatggacacatcaatggtgttcctcaccaaaccatttacagtgccttaatgatcaag
tctgagggtgctggctgtgtaataatcacaggtgtgaagagtggacgctacctatgcatg
gacatgaaaggagacatttttggatcgtattatttcagccaagaggactgtgtgttcaac
caaaggacactggaaaatggatatgatgtgtaccaatctcccaagcacaattttctggtt
agcttgggcagaactaagcaagttttcttccctggtatgaatccaccaccatactcccag
tttttgtccaggagaaacgaaatccctttgtttcgattcaacacacctgaaccccacaga
aacactagaagtgcagatgtcgatccactggatcctcaccaaatcctggtcccacagaga
aaggtctctgcattagggtctcagctgcagctgcaaatggacttttcccatgtgcccaga
gaacccatgagagtcaatcagaatgatgtggtcaatccagatgacccacatgctatgatg
gatgctaggaggtatgctagtcctcgcttttacattacaagataa

DBGET integrated database retrieval system