KEGG   Gallus gallus (chicken): 428145
Entry
428145            CDS       T01006                                 

Gene name
TP53RK
Definition
(RefSeq) EKC/KEOPS complex subunit TP53RK
  KO
K08851  TP53 regulating kinase and related kinases [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    428145 (TP53RK)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gga03016]
    428145 (TP53RK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     428145 (TP53RK)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: Other
  Bud32 family
   428145 (TP53RK)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    428145 (TP53RK)
 Prokaryotic type
    428145 (TP53RK)
SSDB
Motif
Pfam: Kdo APH RIO1 Pkinase PK_Tyr_Ser-Thr EcKinase YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 428145
NCBI-ProteinID: XP_425703
CGNC: 3297
Position
20
AA seq 314 aa
MRGRAVPGGRFCGGFPRAVGGARRVRRFPAAVAEDCRSGERRACAVSRRGPVMAATAGDA
GAAGAEDGAAGPVRDGAETGEPGPGAVEAPPPALPGLQLVQQGAEARVYRGSFLGRAAVA
KLRFPKLYRHPALEERLSRRRTAQEARSLLRCRRAGIPAPVVYFVDYASNCIYLEDIVGA
IAVQDHIYSVQRSGSDASSLLGLAEKMGQLLARMHDEDLIHGDLTTSNVLLRPPAERLDL
VLIDFGLSFISGLPEDKGVDLYVLEKAFLSTHPDTETVFQALLQSYAAASKKSGPVIKRL
DEVRLRGRKRSMIG
NT seq 945 nt   +upstreamnt  +downstreamnt
atgcggggccgcgccgtgcccggggggcggttttgcggcggattccctcgcgcagtcgga
ggagcgcgccgagttcggcgctttccggcggcggtcgccgaagattgccgaagcggcgag
cgacgcgcatgcgcggtgtcgcggcggggcccggtgatggcggcgacggcgggcgacgcg
ggcgcggcgggggcggaggacggggccgcgggcccggtgcgggacggggccgagacgggc
gagccgggccccggcgcggtcgaggcgccgccgccagcgctgccggggctgcagctggtg
cagcagggcgccgaggcgcgcgtctaccgggggagcttcctggggcgcgcggccgtggcc
aagctccgcttccccaagctgtaccggcacccggcgctggaggagcggctcagccggcgg
cgcacggcgcaggaggcgcgatccctgctgcgctgccggcgggcagggatcccggctccc
gtggtctacttcgtggattacgcgtccaactgcatttatctggaagatatcgttggcgcg
atcgctgttcaggatcacatctactccgtgcagcggagcggcagcgatgccagcagcctc
ctcggcttggcggagaagatgggccagctgctggccaggatgcacgacgaggacctcatc
cacggggacctcacgacgtccaacgtgctgctgcggccgcccgcggagcggctggacttg
gtgctgattgactttgggctcagctttatttcgggtcttcccgaggataaaggagtcgat
ctgtacgtgctggaaaaagccttccttagtacccatcccgatacggaaactgtgtttcag
gctctgctgcagagctacgcggccgcctctaagaaatccggcccggtgatcaaacgtctg
gatgaggtgcggctcagggggaggaagaggtccatgattgggtaa

DBGET integrated database retrieval system