KEGG   Gallus gallus (chicken): 428148
Entry
428148            CDS       T01006                                 

Gene name
LAMA5
Definition
(RefSeq) laminin subunit alpha-5 isoform X1
  KO
K06240  laminin, alpha 3/5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    428148 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    428148 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_G_2 Laminin_G_1 Laminin_I Laminin_B Laminin_II Laminin_G_3
Other DBs
NCBI-GeneID: 428148
NCBI-ProteinID: XP_015152145
CGNC: 3962
UniProt: A0A3Q2UJC9
Position
20
AA seq 3689 aa
MARAAERGLRLLVLLLGLGAGLPAAARPPASFPGDVNGHSLHPPYFNLAEGTRISASATC
GEETAGTSGSRRAVEDLYCKLVGGPLAGGDPNQTIQGQYCDICSSANSNKAHPITNAIDG
TERWWQSPPLSRGLEFNQVNVTLDLGQLFHVAYVLIKFANSPRPDLWVLERSTDFGLTYE
PWQYFASSKRDCIEKFGLQTVDRITKDDHAICTTEYSRIVPLENGEIVVSLVNGRPGAMN
FSYSPLLRNFTKATNIRLRFLQTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRCVCH
GHADVCDAKDPSDPYRLQCDCQHNTCGGSCDRCCPGFNQFPWKPATADSANECQPCNCNG
HAYDCYYDPEVDRHKASKSREDKFEGGGVCIDCQHHTTGVNCERCIPGYYRSPDHPIDSP
YICYRCNCKSDFTDGTCEDLTGRCYCKPNYTGEHCNACAEGYLDFPHCYPVPAFAYNDTG
EQVLPAGQIINCDCYAGGTEGNACRKDPRVGMCVCKPNFQGTHCDQCTPGHYGPLCQPCQ
CSGPGQYDGTCDSETGQCLCRTGFEGQLCDRCAPGYFNYPLCQLCGCSAVGTLPGGCDSS
GRCFCKAEFAGPRCEQCSSGHHSYPHCYACSCDSRGAVDNNCSPAGQCRCHVNFTGHTCN
QCALGFYGYPSCTPCQCSREGSLHSTCNQETGQCSCRPKVTGLRCDSCVPGAYGFPHCEV
GSCNPAGLVTADPSLAPGSCACRAYVEGPACDRCKPLYWNLTPDNPYGCTSCKCETKGTI
SGIAECQQGNGQCFCKPNTCGQFCSACKDGYFSMENTNYFGCQGCRCDVGGSLGPSCEER
SGACRCRQNTRGPTCTQPVRDHYFPDLHHLKFELEEGTTPAGRAVRFGYNPLEFEGFSWR
GYAQMSSIQPKVVVTLNVTSPDLFRLVFRYVSRGSAIVEGRVSVVEEGKFNICGNCTEQS
KQIVFAPSTEPAFVTVPQNSFGEPFVLNPNTWSLIVEAEGVLLDYLVLLPSSYYEAPILQ
LKVTDPCTYQPAPEQATQNCLLYKYLSVDGFPAVAGVGAVCRLDNRLPRGCPTEQLTPAH
PRMAMCSGNDVEVQLSLPIAQPGKYVLVVEYANPNALHPVAVAISSPHLAMQQGTFTFYP
CVYSFLCRGVAVDSQSRLATFELTSEATIRFIADLADFFLHKVYLVPAEQFTMEFVEPKV
HCISVHGMFSSNSSSCIPSRFLKHSQSVVLEGGQALPLAAEVPLAQAVHVAPAGVPLEPA
PRPPTAMDSTTELILLQPPQAAVVFNSRIQNLGRYAFVLHYYQPNHPTFPVEVLINGGRI
WQGQTNATFCPHGYGCRSLVVAEDQIVLDVTDNDLMVVVRVPEGKQLWLDYILVVPEDSY
SSQYLQEEPLDKSYDFISSCGINSFYINPSTSSRFCRDSAISLSLFYNNGAQPCQCHEAG
ARGSQCEPFGGQCPCKSNVIGRECSRCATGYWGFPNCRPCDCGTRLCDEVTGQCICPPHT
LKPECVVCEPQTFGCHPLIGCEDCNCSQPGVQELTELGCDVDSGQCKCKPNVIGRRCDLC
APGYYHYPSCRRCDCHPDGTEVSVCDPVTGQCHCKENVEGPRCDQCRLGTFSLDASNPKG
CTKCFCFGATNRCRSAVKYRAEFIDMNGWLLMSSDRQEVPTALSLREQLLRADLRNLLDA
YQELYWVAPSSYLGDRVSSYGGHLRYELHSDPRRGDVFIPMESRPDVILKGNQMSIMFLE
SSYPSPGEIHEGQLQLVESNFRHTETHNPVSREELMMVLANLEQLQIRALFSQLSSSVSL
RRVVLEIATDTATGVPASNVELCFCPANYLGDSCQECAPGYYRDTKGLFLGKCIPCHCNG
HSDQCLPGSGICLNCQHNTEGDHCEQCKDGYVGSRNADGSLQCVGCPCPLSVASNNFAIG
CVHKGSSTQCLCKPGYAGPNCERCAPGYYGNPLVIGSSCQPCDCSGNTDPNMLFSSCDSL
TGTCMGCMHHTAGVRCEVCAPGFYGDAVAAKNCTQCNCSPCGTDSCHPQTGQCFCKAGVT
GQHCDHCEEGYYGFEGCSGCRRCDCDVGAMGSSCHAQTGQCHCLPGVSGSRCQQCAPGYW
GFSERGCRKCECRGGSCDPRTGECTCSNGLTGKQCDVCMHNYEIPVANGPDSMRCEVCDS
CVLLLLEDLQSIEMSFPSIRSQLLNLSASSIAWARLHSLNSTMATVANQLREYHRAMNKV
RQRADELEDENIDLTQDLNALQHRMMMAHSKANHLEQHTRETYQRGEQLLLIIQSIQKSI
GDLVRQMATFGAANTSTTSTEEFRQKMAEVERMLREMKQRSLGGQEELARREHKEAQKLL
HRVKNELHAHWESNQALVSSIQDWLTQHSSQLMDLRDALNEAVNKTRQTEDLNSLNRNNL
EESQQKSRELQKQYGLVQETLRMAESALAKVSNFLQKMESAKEAYEKLAALLDGAKLPLT
ERVKKFSPASSKIPIVEQAEEHARLLDELARNLSSIIQGTNQDGFIQRAIDASNVYASII
EAVRKAERAAHDAHEAAGEALMNVMSENLGAISKELKRNSSNLEEAVRREQTKLNGAIKG
TLQTAKNKLADLRRKKEQLLSQLQSVQDMLGRDQEDTKETIQNAKAAATEANQTAARVEE
TLSTMKKNLDEWKDKYGGLRNEDLNQAVQDARKSVSSLESTIPLLLGKLSSLENRRNKNA
TVSENIVRIRQLITQARNAASKVKVPMKFNGSSGVQVRMPSNLQDLAAYTSLKFYIQNPE
PRSQQDGAEEGRFVLYLGSREATGDYLGIVLKDRKVQWVYKLGNEEPASLTVDEEIGEQF
AAININRILQYGQMSVIVERQTVHETKGDSVAKGEQGLLNLDPHNVVFYVGGYPPSFMPP
PTLRYPNYRGCLELDTLNEEVVSLYNFQHTFQLDTTAEKPCARSKSTGDPWLTDGSYFDG
TGYAEIKFESQFGTTKRFEQEIRIISYNGILFFLENQGQFLCLAIRNGKLVLYYDFNTGL
EMAKPSSNASSISSATNKAIQIFLLKMNNKKRILVRLERLTIFVVEQENSLENAVSYYLG
GVPPAVLPPSLKALFPTGGPIRGCMKGLKALGKYVDLKRMNTVGVSYGCTSDLLVARSIS
VHGYGYLTLALKDVPGLRDFYSGFSFQTSQREGLLYHHSTQEGMCQVSLQRGQLALNLLE
TKVTTENTYADDRTHYVAFYSDAQGVRLYVDDELQDTAVGARASRRQRRQQDGRALFQLG
GSPEPGALSNLTGCIGNVFVKRRSEPQMVVDLQQNVESINVTMSCPWGERPQQLRVALKK
DRRKPKVPSRPSSKDRRHNQAGLCQPQPRTTRGSFRFGGSPSSRWEFEEIPASFSQRSHF
SLEVRLNSSNGLLFYVAGERGTSMALFVSNGRFIFLVDIGGRRLRIRSKEKYHDRRWHTV
FFSRDQSRAQLVIDGLRAQSAAVATAELFVAQTPLYVGGVPDGRAKAHMLGTSVSSFDGC
LRNPQLDGKPLGTPSHTFGVTPCYEGALESGVFFAADGGSITLADALATEQDLEVTLEVR
PHSASGLIFHIGTRRSHHSLVLYMEETKVTMRANTGADEFSTSVTCPSLCDGQWHTITAT
KRKNIIQVEVDTERNYAVGPSWPPAPSARAMFYLGGLQEADEASPVSALPPLPHYVGCIR
NLLVNGSHVNLLQTRTVRGSVGLKGCPVL
NT seq 11070 nt   +upstreamnt  +downstreamnt
atggcgagggctgcggagcgggggctgcggctcctggtgctgctgctgggactcggagcg
gggctgcccgccgccgctcgcccgcccgcctccttccccggcgacgtgaacgggcacagc
ctccacccgccctacttcaacctggccgagggcacccgcatctccgcctccgccacctgc
ggcgaggaaacggcggggacgtccggcagccgccgcgccgtggaggatctgtactgcaag
ctggtgggggggccgctggcggggggggaccccaaccagaccatccagggccagtactgt
gacatctgctcctcagcaaacagcaacaaggcacatcccataacgaacgccatcgatggg
acggagcgctggtggcagagccccccgctgtcccgtgggctggagttcaaccaggtcaac
gtcactctggaccttggacagctcttccacgtggcgtatgtcctgatcaaatttgcaaat
tcccctcgtcctgacctctgggtgctggaacgatctactgactttggcctcacctatgag
ccctggcagtactttgcctcttcaaagagggactgcattgagaaattcggactgcagacc
gtggatcgcatcaccaaggatgaccatgctatctgcacgactgagtactcccgaattgtg
cccttagaaaatggggagattgttgtctctctggtaaatgggcgcccaggagccatgaac
ttctcctactctcctctcctacggaatttcacaaaggccaccaacatcagactgcgcttc
ctgcagacaaacactctgcttgggcacctgatgggcaaagctttgagggaccctacagtg
accaggaggtattactacagcatcaaagatatcagcattggagggcgctgtgtctgccac
ggccatgcagatgtctgcgatgctaaagaccccagtgacccttacaggctgcagtgtgac
tgccagcacaacacctgcggcggctcctgtgaccgctgctgccctggcttcaaccaattc
ccgtggaaacctgccactgccgacagtgccaacgaatgccagccttgcaattgcaatggc
catgcctacgactgctactacgacccagaggtggatcgccacaaagccagcaaaagtcgc
gaggacaagtttgaaggaggaggtgtttgcattgactgtcagcatcacaccactggcgtt
aactgtgagagatgcatcccaggatactaccgctcccctgaccaccccatcgactctcca
tacatttgctatcgttgcaactgcaagtctgacttcactgatggcacctgtgaggacctc
actggccgctgttactgcaaacccaactacaccggggagcactgcaatgcctgtgctgag
ggatacctggacttcccccactgctaccctgttccagcctttgcttataacgatactgga
gaacaagtgctccctgcaggacagataataaactgcgactgctatgctggtgggacagaa
ggcaatgcctgccgcaaggaccctcgagtagggatgtgcgtgtgcaaacccaacttccaa
gggacacactgtgaccagtgcactccaggccattatggacccctctgccagccctgccag
tgctccggcccaggtcagtacgatggcacctgtgacagtgagacaggacagtgcctgtgt
cgaacaggatttgaagggcaattgtgtgatcggtgcgctcccggctacttcaactacccc
ctgtgccagttgtgtggctgcagtgctgttgggacgctgccaggaggctgtgactcctct
gggaggtgtttctgcaaggccgagtttgcagggccacggtgtgagcagtgcagctccggg
caccactcctacccccactgctatgcttgctcctgcgactcccggggtgctgtggacaac
aactgcagcccagctggccagtgccgatgccatgtgaattttacggggcacacctgcaac
caatgtgccctgggcttctacgggtaccccagctgcacaccctgccagtgctccagggag
ggctctctgcacagtacgtgtaaccaggagacggggcagtgcagctgccggcccaaagtg
acagggctgcgctgtgacagctgcgtgccgggtgcctatggatttccacactgtgaagtg
ggctcctgtaacccagctgggttagtgactgcagatccctcgctggccccaggctcctgt
gcatgtcgggcatacgttgaaggcccagcttgtgacagatgcaagcccttgtactggaac
ctgactccagataacccttatggctgcacgagctgcaagtgtgagaccaagggcaccatc
agtggaattgcagagtgtcagcagggcaatgggcagtgcttctgcaaaccgaacacctgt
ggacagttctgctcagcatgcaaagatggttacttcagtatggagaacacaaattacttt
ggctgccaaggctgccgctgcgacgtcggcggttcgctggggccatcctgcgaggagcgg
agcggagcctgccgctgccggcagaacacgcgtgggcccacctgcactcaacccgtgcgg
gaccattatttccctgaccttcaccacctgaagtttgagctggaggaagggaccacgcca
gccggccgggccgtgcgcttcggctacaacccgctggagttcgagggtttcagctggcga
ggatacgcacagatgtcctccatccagcccaaggtagtggtgactctcaatgtgacctcc
cccgacctcttccgcctcgtcttccgctacgtcagccgggggtccgccattgttgaaggg
agggtctcggtcgttgaggaaggaaagtttaatatttgtggcaactgtacagagcagagc
aagcagattgtctttgctcccagcacggagccagcctttgtcaccgtcccccagaacagc
tttggggagcccttcgtactcaaccccaacacgtggtctctgattgtcgaagcagagggt
gtgctgctggactatttggttttgctacccagctcatactatgaagctccaatactgcag
ctaaaggtcacggatccgtgtacataccagccagccccagaacaagccacccagaactgc
ctcttgtataagtacctgtctgtggatggcttccctgctgtggcaggggtgggtgcagtg
tgcaggctggacaaccggttacccagaggctgccccacggagcagctcacccctgcccat
cctcggatggcgatgtgcagcggcaacgacgtggaagtccagctgtcgctgcctattgcc
caacctggaaaatatgtgttggtggtggagtacgccaaccccaatgctttgcatccggtg
gccgttgccatcagctcaccgcacttagccatgcagcagggcacgttcaccttctacccg
tgtgtctacagtttcctttgtcgaggggttgctgtggattcccagagcagattggcaact
tttgaacttacctcggaggccacgattcggttcatcgctgacctggctgacttcttcctg
cacaaagtgtaccttgttcctgctgagcagttcaccatggagtttgttgagccgaaggtg
cattgcatcagtgtccatggcatgttctcatccaatagcagctcctgcattccctcaagg
ttcctaaagcattcccagtcggtcgttttggaggggggccaggctctgcctcttgccgct
gaagtccctctggctcaggctgtccatgtggctccagctggggtcccactggagcctgca
cctcggcctcccactgcaatggactccaccacagagctcatcctcctacagccaccacag
gctgctgttgtgtttaacagccggattcagaacctggggcgctatgcttttgttctgcac
tactaccaacccaaccatcccaccttccccgtggaagtgttgatcaacggtgggcgcatc
tggcaaggtcagaccaatgctactttctgtccacatggctacgggtgccggagcctggta
gttgctgaggaccagattgtcctcgatgttactgacaatgatctgatggtggttgttcga
gtcccggagggcaagcagctgtggctggattacatcctcgtggtgccagaggacagctac
agctctcagtacctgcaggaggagcccctggacaagtcctacgacttcatcagcagctgt
ggcattaacagcttctacatcaatcccagcacatcgtcgaggttttgccgtgactccgcc
atctcgctgtccctcttctacaacaatggggcacagccctgccagtgccatgaggcgggg
gcacggggcagccagtgcgagccctttggtgggcagtgtccctgcaagtccaatgtcatc
gggcgagagtgctcccgctgcgccaccggctactggggcttccccaactgcaggccctgt
gactgtgggacacgactctgcgacgaggtgacagggcagtgcatctgccctcctcacacc
ctgaagccagaatgtgttgtctgtgagccccagaccttcggttgccatcccctcatcggc
tgtgaggactgcaattgctcgcagcctggagtgcaggagctgacagagcttggctgtgat
gtggacagcgggcagtgcaagtgtaagcccaatgtaattgggcgacggtgtgacctctgt
gcccctggctactaccactatcccagctgtcggcggtgtgactgccatcctgatggcacc
gaagtgagcgtgtgtgacccggtgacggggcagtgtcactgcaaggaaaatgtggagggt
ccgaggtgtgaccagtgccgcctggggacgttttctttggatgccagcaaccccaagggg
tgcaccaagtgtttctgctttggtgccaccaatcgctgccgcagtgctgtgaagtaccga
gctgagttcatcgacatgaatggctggctcttgatgagcagtgaccgccaggaggtgcca
acagccctgagcctgcgggagcagctgctccgtgctgatctcaggaacctcctggatgcc
tatcaggagctctactgggttgcacctagctcctaccttggggaccgggtttcctcctac
ggcggccacctgcgctacgagcttcactctgacccacggagaggtgatgtcttcattccc
atggagtcccgtccggacgtgatcctgaagggaaatcagatgagcatcatgtttctggaa
agctcctacccttccccaggggagatacatgaaggccagctgcagctggtggagagtaac
ttcaggcacacggagacacacaaccctgtatcgagagaggagctcatgatggtgctggca
aacctggagcagctgcagatccgggcactcttctcccagctctcctcctccgtgtccctg
cgtcgtgtggtcctggagattgcaacagatacagctacaggtgtccccgcaagcaacgtg
gagttgtgcttttgcccagctaactacctgggtgactcctgccaggaatgcgctccaggt
tactacagggacaccaaggggctatttttggggaaatgcatcccatgtcattgcaacggc
cactcagaccagtgcctgccagggtctgggatatgccttaactgccagcacaacacagag
ggagatcactgtgagcagtgcaaggatggctacgtgggcagccgcaatgccgacgggagc
ctgcagtgtgtcggatgtccgtgtcctctttccgttgcctccaacaatttcgccattggt
tgtgtgcacaagggctccagcacacagtgcctctgcaagcctggctacgctggacccaac
tgtgagcggtgtgccccaggatactatggcaatcccctggtgattggcagctcgtgccag
ccctgcgattgcagcgggaacacggatccaaacatgctgttcagcagctgtgactcccta
acaggcacctgcatggggtgcatgcatcacacagctggtgtgcggtgtgaggtctgcgcc
cctggcttctatggggatgcagtggcagccaagaactgcacacagtgcaactgttcacct
tgtgggactgactcatgccatccacaaaccggccagtgcttctgcaaggctggagtgacg
gggcagcactgcgaccactgcgaggaggggtactacggcttcgagggatgctctggctgc
aggaggtgtgactgtgatgtcggtgccatggggagcagctgtcacgcacagacaggccaa
tgccactgcctgcccggcgtcagcggctcgcgctgccagcagtgtgccccaggctactgg
ggcttcagcgagaggggctgcagaaagtgtgagtgcagagggggctcttgcgacccacgc
actggggagtgcacctgctccaacgggctgacggggaagcaatgcgacgtctgcatgcac
aactacgagatccctgtggcaaacggcccagacagcatgaggtgtgaagtgtgtgacagc
tgcgtcctgctcctgctggaggatctgcagagcattgagatgtccttcccctccatccga
agccagctgctcaacctcagcgccagctccatcgcctgggctcgcctccatagtctcaac
agcactatggcgactgttgctaaccaactgcgtgagtaccacagagctatgaacaaagtc
aggcaaagggctgatgagctggaggatgagaacatagacctcacacaggacttgaatgcg
ctgcagcacagaatgatgatggctcacagtaaagcaaaccatttagagcagcatacaagg
gagacttaccagagaggagagcaacttctgctaatcattcaaagtattcagaaaagcatt
ggagacctggtgcggcagatggccacgtttggggcagcaaacaccagcaccacctccact
gaggagtttcggcagaagatggcagaggtggagaggatgctgagggagatgaagcagcgg
agcctgggtggccaggaggagctggcaaggcgtgagcacaaggaggctcagaagttgttg
caccgggtgaagaacgagcttcatgcccactgggagtccaaccaggcactggtgagcagc
atccaggactggctgacacagcacagctcccagctgatggatctccgtgatgctctcaac
gaggctgtcaacaaaaccaggcagacagaagacttgaacagtttgaaccgcaacaacctg
gaggagagtcagcaaaagagccgtgaactccaaaagcagtatgggctggtgcaagagacc
ctgaggatggctgagagtgccctggccaaggtctccaacttcctacagaagatggagagt
gcaaaggaggcatatgagaagctggcagcccttctggatggggcaaagctgcctctgaca
gagcgagtcaagaagttctccccagccagcagtaagatccctattgtggagcaggctgag
gagcacgcccggctcctggatgagctggcaaggaacctgtccagcattatccagggcaca
aaccaagatggctttatccagagggcaatcgatgcctccaatgtctatgccagcatcatt
gaagcagtgagaaaagctgagcgagctgcccacgacgcccatgaggctgctggcgaggct
ttgatgaatgtcatgtcagaaaatctcggggccatctctaaagagctgaagaggaacagc
agcaaccttgaggaggctgtgaggagagagcagacaaaactcaatggggctattaaaggc
actctgcagacagcaaagaacaagctggctgacctccgcaggaagaaagagcagctcttg
agccagctgcagtctgtgcaggatatgctgggcagggaccaagaggacaccaaggagaca
atccagaatgccaaagcagctgcgacagaggccaaccagacagctgcaagagtggaagag
accctgagcaccatgaagaagaacctggatgagtggaaagacaagtatggaggccttcga
aatgaagacctgaaccaggcagtccaagacgccaggaaatctgtgtccagcctggaaagc
accatccctctgctgctggggaagctgagcagcctggagaacagaaggaataagaatgcc
actgtgtcagagaacattgtgcgcatccggcagctcatcacgcaggcgaggaatgctgcc
agcaaggtgaaagtccccatgaagttcaatggcagctcgggcgtgcaggtccggatgccg
agcaatctgcaggatttggcagcctacacatccctcaaattctacatccaaaaccctgag
cccaggagccagcaggatggggcagaggaggggcggttcgttctgtacctgggcagccgg
gaggccactggagactacctgggtattgtgctgaaggaccgcaaagtgcagtgggtctac
aaactgggcaatgaggagccagcttccctgaccgttgatgaggagatcggagagcagttc
gctgccatcaacatcaacaggatcctgcagtatgggcagatgtccgtgatagtggaaagg
cagacggtgcatgagaccaagggagacagcgtggccaagggggagcaggggctgctcaac
ctcgacccacacaacgtggtcttctacgtgggtggctacccacccagcttcatgccccct
cccactctgcgttatcccaactaccgtggatgcctggagctggacacgctgaatgaggag
gtggtgagtctgtacaacttccagcacaccttccagttggataccaccgctgagaagccc
tgtgcaaggtccaagtcaacaggagatccctggctgactgacggctcctactttgatgga
actggttatgcagagatcaagtttgagagtcagtttggcacaaccaagcgttttgagcag
gagatccggatcatctcctacaatggcatcctcttctttctggagaatcagggacagttc
ttgtgcctggccatccggaatgggaagctggtgctttactatgacttcaacacgggcctg
gagatggcaaagcccagcagcaatgcttcctccatcagcagcgccacgaacaaagcgatc
cagatcttccttctcaaaatgaataacaagaagcgcatcctggtgcgtctggagcgcctc
accatcttcgtggtggagcaggagaactccttggagaatgctgtgtcctactacctgggc
ggtgtgcccccagcagtgctgccccccagcctgaaggcactcttccccacgggtgggccc
atccggggctgcatgaagggcttgaaggctctcggcaaatacgttgacctgaagcgcatg
aacactgttggcgtgagctacggatgcacctcagaccttctggtggctcgctccatcagc
gtccatggctatggttacctgaccctggccctgaaggatgtgcctgggctgcgggacttc
tacagtggcttcagcttccagacaagccagcgtgaggggctgctgtaccaccacagtaca
caggaggggatgtgccaggtatccctccagaggggccagctggccttgaacctgctggaa
accaaagtcaccactgaaaatacctatgcggatgacaggacccactacgtggccttctac
agtgatgcccagggggtgcggctctatgtggacgatgagctgcaggacactgcagttggg
gccagggccagtcggaggcagcggcggcagcaggatggccgggcactcttccagcttgga
ggctcgccagagcccggtgccctcagcaacctcaccggctgcatcgggaacgtctttgtc
aagcggaggtcagagccgcagatggtggtggacctgcagcagaatgtggagagcatcaac
gtcaccatgagctgtccttggggagagcggccgcagcagctcagagttgctctgaagaag
gacaggaggaaacccaaggtacccagcaggcccagctccaaggaccgccgccacaaccag
gccgggctctgtcagccgcagccccgcacaaccaggggctccttccgcttcggggggtcc
ccgagcagccgctgggagtttgaggagatcccggcctccttcagccagaggtcccatttc
tccctggaggtgaggctgaactcctccaacgggctgctcttctacgtggcgggcgagcga
ggcacctccatggctctctttgtctccaatgggcgcttcatcttcctggtggacatcggt
gggcgccggctgcgcattcgcagcaaagaaaagtaccacgaccggcgatggcacacggtc
ttcttcagcagagaccagagccgagcccagctggtcatcgatgggctgcgagcccagagt
gctgcagtggccaccgcagagctctttgtagcccagacccccttgtatgtggggggggtc
ccagatggaagagccaaggctcacatgctgggcacgtcggtctccagctttgacggctgc
ctgaggaacccgcagctggacgggaagcccctgggtaccccctcacacacctttggggta
acgccgtgctatgagggtgctctggagagtggagttttcttcgcagcagatggcgggtcc
atcaccctagctgatgcactggcaactgagcaggacttggaggtgacactggaagtccgt
ccccacagtgcctctgggctcatcttccacatcgggacaaggaggagtcaccacagcctt
gtgctgtacatggaggagacaaaggtcaccatgagagccaacactggggctgacgagttc
tccacgtcggtgacgtgcccatcactctgtgacgggcagtggcacaccatcacagctacc
aaaaggaaaaacataatccaggttgaagtggacacagaaagaaactatgcagtgggaccc
agctggcctcctgcacccagtgcaagggcaatgttctacctaggagggctgcaagaagca
gacgaggccagtccagtgtcagcactacctccccttcctcattacgtgggctgcataagg
aatctgctggttaacgggagccatgtgaacctgctgcaaacaaggactgtcaggggctct
gttggcctgaagggttgtcccgtgctgtag

DBGET integrated database retrieval system