KEGG   Gallus gallus (chicken): 428221
Entry
428221            CDS       T01006                                 

Gene name
COL8A2
Definition
(RefSeq) collagen alpha-2(VIII) chain
  KO
K23455  collagen type VIII alpha
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Collagen C1q BclA_C
Other DBs
NCBI-GeneID: 428221
NCBI-ProteinID: XP_425780
CGNC: 1637
Ensembl: ENSGALG00000002298
UniProt: F1P194
Position
23
AA seq 694 aa
MLPDAAVLLLLLLLVGLRAAAAGGAAGYAQVKYMQPMVKGPLGPPFREGKGQYLDMPPLL
PMDLKGEPGPPGKPGPRGPPGPPGYPGKPGTGKPGMHGQPGPAGPPGFSGIGKPGIPGLP
GKAGMKGMPGAKGEPGMRGEQGPRGLPGPPGLPGPAGISVNGKPGPQGGPGLPGFRGEPG
PKGEPGPRGERGMKGENGVGKPGLPGPRGNGGPPGPAGPPGPVGVGKPGLDGLPGAPGEK
GDMGPPGGPGVSGEPGPAGPRGPPGIDGIGVPGAAGVPGIQGPMGPKGEPGIRGPPGLPG
ATGYGKPGLPGLKGDRGQPGVPGAIGDKGEPGVDGEPGEQGPAGVIGPPGPPGSMGLPGK
HGLPGPKGDAGPSGPPGMPGMRGDQGPNGFAGKPGVPGERGLPGSQGPPGPAGPKGEPGF
IGLPGVPGLTGGPGPKGDGGIPGQPGLRGPSGIPGLQGPAGPMGPQGLPGLKGEPGLPGV
PGEGKMGEPGMAGPIGPPGMPGTPGLNGPPGPPGPPGPPGAPGVFDETGIAGLHLPDGGV
EGAVLGNGKPGKPQYGRGELSARIAPAFTAILTSPFPASGMPVKFDRTLYNGHNGYNPVT
GIFTCPISGIYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGSAVLELKE
NDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgctgccggacgctgcggtgctgctgctgctgctgctgctggtcggccttcgtgcggcg
gcggcgggaggagcggccggatacgcgcaggtcaagtacatgcagcccatggtgaagggg
cccctgggacccccgtttcgggaaggcaaagggcagtaccttgacatgccgccgctgctg
cccatggacctcaaaggggagcccggaccaccagggaagcccggcccacgtggccccccc
ggaccccccggctacccaggaaaaccaggcacagggaagccgggcatgcatggtcagccg
gggcctgcggggccccctggcttctctggcattgggaaacccggcatcccaggactgcct
ggcaaggcgggtatgaaggggatgcccggagccaagggcgaacctggcatgcggggagag
caagggcccagaggactgcccggccctccagggctgccagggcctgctggcatctcagtc
aatgggaaacctggaccccagggtggcccggggctgccagggtttcggggtgagcctggc
cctaaaggagagccaggaccccgtggggagagagggatgaagggtgaaaatggagtgggg
aaaccagggctgccggggccacggggcaatggtggccctcctggccctgcggggccgcca
ggacctgttggcgttggcaaacccggccttgatgggctgcctggcgcaccaggggagaag
ggtgacatgggcccccccggggggccgggggtcagtggggagcctggccctgcagggcca
cgggggccgcctggcatcgatgggatcggtgtccccggtgccgcgggggtgccagggata
cagggccccatggggccaaagggggaaccgggcatccgcggcccccccggtttaccaggc
gccacaggctacgggaagccaggcttgcccggcctcaaaggagaccgcgggcagcctggg
gtgccaggagccattggcgataaaggggaacccggagtcgatggtgagccgggcgagcag
ggccctgccggtgtcatcgggccaccaggcccaccggggtccatgggcctaccgggcaaa
catgggctgccaggccccaagggtgatgcggggcccagtgggccaccgggaatgccgggg
atgcgaggtgaccagggcccaaacggcttcgcagggaaaccaggagtgccaggagaaagg
ggtctgcccggatcacagggcccccccggcccggcaggccccaaaggagaaccggggttc
atcggcctccccggggtgccgggattgacgggcggccccgggcccaaaggggatggtggg
atcccggggcagccggggctgaggggcccctccggcatccccggcttgcagggacccgcg
gggcccatggggcctcaggggctgccggggctcaaaggggagccggggctccccggggtt
cccggtgaggggaagatgggcgagcccggcatggccggccccatcggcccaccgggaatg
ccgggaacaccggggctcaacgggccgcccggcccccctgggccacccgggccaccggga
gcaccgggggtgtttgacgagacgggcatcgcggggctgcacctgcctgacggcggcgtg
gagggggccgtgctgggcaacggcaagccgggcaagccgcagtacggccgaggagagctc
tctgcccgcatcgcgcccgccttcaccgccatcctcacctcccccttcccggcgtccggc
atgcctgtcaagttcgacaggactttgtacaacgggcacaacggctacaacccggtcacg
gggatcttcacctgccccatctccggcatctactactttgcctaccacgtgcacgtcaaa
gggaccaacgtctgggtggctctttataagaacaacgtgcccgccacctacacctacgac
gagtacaaaaaggggtacctggaccaggcgtcgggcagtgccgtgcttgaactgaaggag
aacgaccaggtctgggtgcagatgccctctgaccaggccaacgggctgtactccacggaa
tacatccactcctccttctctgggttcctgctgtgccccacataa

DBGET integrated database retrieval system