KEGG   Gallus gallus (chicken): 428231
Entry
428231            CDS       T01006                                 

Gene name
MYCL
Definition
(RefSeq) protein L-Myc
  KO
K09110  L-myc proto-oncogene protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428231 (MYCL)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    428231 (MYCL)
SSDB
Motif
Pfam: Myc_N HLH DUF3287
Other DBs
NCBI-GeneID: 428231
NCBI-ProteinID: XP_425790
CGNC: 16978
Ensembl: ENSGALG00000024047
UniProt: F1NXY9
Position
23
AA seq 347 aa
MERDAYQHYLYDYDAGEDFHRSTAPSEDIWKKFEFVPTPPLSPLGERPGCSAAEERGCPP
RCCLPDEPEYLIGTGQLFGNLSAFILRDCMWSGFSARERLEKAMTEKLSTGTPRAAPHKP
SSAPDLGFGSSVSECVDPAAVFLCPLAESKVPPSSGSEGQSDSEGEEIDVVTVEKRQSLS
LRKPVTITLRADPLDPCMKHFHISIHQQQHNYAARSPPDACPQPKSPQQDEEELLSAAEP
PPSHALPDPGLPKAGPGSDSEDVAKRKNHNYLERKRRNDLRSRFLALRDQVPGLASCPKT
PKVVILSKSSEYLQSLISAERRMAAEKRQLRLRQMQLLRQIAQLKGH
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagcgggacgcgtaccagcactacttgtacgactacgatgcgggggaggattttcac
cgctccacggctcccagcgaggacatctggaagaagttcgagttcgtccccacgccacct
ctctcgcccctcggggagcggccgggctgctcggcggcagaggagcggggctgccccccg
cgctgctgtctgcccgacgaacccgagtaccttatcggcaccgggcagctcttcggcaac
ctgagcgccttcattctgcgggactgcatgtggagcggcttctcggcccgggaacggctg
gagaaggcgatgacggagaaactttccacgggaactccgcgggcagcgccgcacaaaccg
tcctcagcccccgatctgggcttcggcagctccgtgagcgagtgcgtggaccccgccgcc
gtgttcctgtgccccctggccgagagcaaagtgcccccgtcctcggggtcggaggggcaa
agcgattctgagggtgaagagattgatgtggtcacggtggagaagagacaatcgctcagc
ctgcggaagccagtcaccatcacgctgcgtgccgaccccctggacccctgcatgaagcac
ttccacatctccatccaccagcagcagcacaactacgccgctcgctcaccgccggatgcc
tgtccccagcccaagtccccgcagcaggacgaggaagagctgctcagcgctgcagaacca
cccccctcccatgcgctgcctgaccccggtttgccaaaagctggccccggctctgacagc
gaagacgtggccaagaggaaaaaccacaactacctggagcgcaagcggcgcaatgacctg
cgctcacgcttcctggcgctgcgggaccaggtgcccgggctggccagctgccccaagaca
cccaaagtggtgatcctgagcaaatcctccgagtacctgcagtcgcttatcagcgctgag
cggagaatggcagctgagaagcggcagctgcggctgcggcagatgcagttgctcagacag
attgctcagctcaaggggcactag

DBGET integrated database retrieval system