KEGG   Gallus gallus (chicken): 428253
Entry
428253            CDS       T01006                                 
Symbol
NCAM1
Name
(RefSeq) neural cell adhesion molecule 1 isoform 1 precursor
  KO
K06491  neural cell adhesion molecule
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    428253 (NCAM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    428253 (NCAM1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    428253 (NCAM1)
   04090 CD molecules [BR:gga04090]
    428253 (NCAM1)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    428253 (NCAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
    428253 (NCAM1)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    428253 (NCAM1)
Cell adhesion molecules [BR:gga04515]
 Immunoglobulin superfamily
  NCAM1/2
   428253 (NCAM1)
CD molecules [BR:gga04090]
 Proteins
  428253 (NCAM1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   428253 (NCAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
 Others
  428253 (NCAM1)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_5 C1-set Ig_C17orf99 Izumo-Ig Receptor_2B4 Pur_ac_phosph_N Collagen_bind_2
Other DBs
NCBI-GeneID: 428253
NCBI-ProteinID: NP_001122300
CGNC: 5910
Ensembl: ENSGALG00000007839
UniProt: A0A1D5PQ40
Position
24:complement(5811349..5892244)
AA seq 1109 aa
MLPAAALPWTLFFLGAAASLQVDIVPSQGEISVGESKFFLCQVAGEAKYKDISWFSPNGE
KLTPNQQRISVVRNDDFSSTLTIYNANIDDAGIYKCVVSSVEEGDSEATVNVKIFQKLMF
KNAPTPQEFKEGDDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPSVRARQSTMNATANLSQSVTLACDADGF
PEPTMTWTKDGEPIEQEDNEEKYSFNYDGSELIIKKVDKSDEAEYICIAENKAGEQDATI
HLKVFAKPKITYVENKTAMELEDQITLTCEASGDPIPSITWKTSTRNISNEEKTLDGRIV
VRSHARVSSLTLKEIQYTDAGEYVCTASNTIGQDSQAMYLEVQYAPKLQGPVAVYTWEGN
QVNITCEVFAYPSAVISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCT
AVNRIGQESSEFILVQADTPSSPSIDRVEPYSSTARVEFDEPEATGGVPILKYKAEWRAL
GEGEWHSRLYDAKEANVEGTITISGLKPETTYSVRLSAVNGKGVGEISLPSDFKTQPVRE
PSAPKLEGQMGEDGNSIKVNVIKQDDGGSPIRHYLIKYKAKHSSEWKPEIRLPSGSDHVM
LKSLDWNAEYEVYVIAENQQGKSKPAHYAFRTSAQPTVIPASTSPTSGLGTAAIVGILIV
IFVLLLVAVDVTCYFLNKCGLLMCIAVNLCGKSGPGAKGKDMEEGKAAFSKDESKEPIVE
VRTEEERTPNHDGGKHTEPNETTPLTEPEHTADTAATVEDMLPSVTTGTTNSDTITETFA
TAQNSPTSETTTLTSSIAPPATAIPDSNAMSPGQATPAKAGASPVSPPPPSSTPKVAPLV
DLSDTPSSAPATNNLSSSVLSNQGAVLSPSTVANMAETSKAAAGNKSAAPTPANLTSPPA
PSEPKQEVSSTKSPEKEAAQPSTVKSPTETAKNPSNPKSEAASGGTTNPSQNEDFKMDEG
TFKTPDIDLAKDVFAALGTTTPASVASGQARELASSTADSSVPAAPAKTEKTPVEDKSEV
QATETKTPPAEVKTVPNEATQTNENESKA
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgctgcccgccgccgcgctgccctggacgttgttttttctcggagccgcagcctctcta
caagtggatattgttccaagtcagggagagatcagcgttggagaatccaagttcttctta
tgtcaagtggcaggggaagccaaatacaaagacatttcctggttttcccctaacggtgag
aagctgacgcccaaccaacagcgcatctcagtggtgcgaaatgatgacttctcctccacc
ctcaccatctacaacgccaacattgatgatgctggcatctataaatgtgttgtcagcagc
gtggaggagggagactctgaagccaccgtcaatgtgaaaattttccaaaagctcatgttc
aagaatgcccccactcctcaggaattcaaggaaggggatgatgctgtgattgtgtgtgat
gtggtcagctcgctgcctcctaccatcatctggaaacacaaaggcagggatgtcatccta
aaaaaagatgttcggtttatagtgctgtccaacaactacctgcagatccggggaatcaag
aaaacagatgaagggacgtaccgctgtgagggccgcatcctggctcgtggggagatcaac
ttcaaagatattcaggtcattgtaaatgtacctccttctgtgcgtgccaggcagagcact
atgaacgccactgccaacctcagccagtctgtcaccttagcatgtgatgctgatggcttt
cctgagccaaccatgacgtggacaaaggatggagagccaatagagcaggaggataacgaa
gagaaatacagttttaactatgatgggtccgagctgatcatcaagaaggtggataagagt
gacgaagcagagtacatctgcatcgctgagaacaaggctggcgagcaggatgccaccatt
catctcaaagtctttgcaaaacccaaaatcacatatgtggagaataaaacagctatggag
ctggaggatcagatcacactgacctgtgaggcctctggggacccaatcccttccatcacg
tggaaaacttccacccggaacatcagcaatgaagagaagaccctggatgggcgcatcgtg
gtgcgcagccacgcgcgggtatcgtccctgactctcaaagaaatccagtacacagacgcc
ggagagtacgtgtgcacggccagcaacaccatcgggcaggactcacaggccatgtacctc
gaagtgcagtatgctcccaagcttcagggccctgtggctgtctatacctgggaagggaat
caagtgaacatcacctgtgaggtatttgcttatcccagtgctgtcatctcctggttccga
gatggacagctgcttcccagctcaaactacagcaacatcaagatctacaacactccatca
gcaagctacctggaggtgacaccagactctgaaaatgactttggcaactacaactgcact
gctgtgaaccgcattggccaggaatcctcagagttcattcttgtgcaggcggatactccg
tcctctccttctattgacagagtggagccctactctagtactgcccgtgtggagttcgat
gagcctgaagctactggtggggtgcccatcctcaaatacaaagcagagtggagagcactg
ggtgaaggagaatggcactcaagattgtatgatgcaaaagaggcaaatgtggagggcacg
atcactatcagtggcctgaaacctgagacaacctactcagtgagactgtctgcagtcaat
ggcaagggtgtgggtgagattagcctgccatccgacttcaagacacagccagttcgggaa
cccagtgcacccaaactggaagggcagatgggagaagacggaaactccatcaaagtgaac
gttatcaagcaggatgatggtggctccccaatcaggcattacctgatcaaatacaaagct
aaacattcctcagaatggaaaccagagatcagactgccttctggcagtgaccacgtcatg
ctcaagtctctggactggaatgcagagtatgaggtttatgtgatagctgaaaaccagcag
gggaagtccaaacccgctcactacgctttccggacatctgctcagcctactgtcatccca
gccagcactagccctacgtcaggcctggggactgctgccatcgtaggcattctcattgtt
atctttgtgctgctcctggtggctgtggacgtcacctgctacttcctgaacaaatgtggc
ctgctcatgtgcattgctgtcaacttatgtggcaagtctggaccaggagccaagggcaaa
gacatggaggagggcaaagctgccttctcgaaagatgagtccaaggagcctattgtggaa
gtgcggactgaagaggagcggacccccaaccatgatgggggaaaacacacagagcccaac
gagaccaccccactaacagaaccagagcacaccgccgatactgcagctactgttgaggac
atgctgccttctgtaactacgggcaccactaactctgacactatcactgaaacttttgcc
actgctcagaacagccccacgagcgagaccaccaccctgacctccagtattgccccgcca
gccacggccattcctgactcaaacgccatgtcgcctggccaggctactccagccaaagcg
ggagcctcccctgtctctccaccaccaccctcctctacgcccaaagtggccccccttgtt
gatctcagcgataccccaagctctgctccagctactaataatttgtcttcaagtgtcctg
tccaaccaaggtgcagtgctgagccccagcactgttgctaacatggccgagacctccaaa
gcagcagctggtaacaagtcagctgccccaacccctgcaaacctcactagtcctccagct
ccatcagagcccaagcaggaggtctcaagcaccaagagccccgagaaagaagctgcgcag
cccagtacagtgaagagcccaacagagacagccaagaatccaagcaatccgaagagtgag
gctgcttcaggcggcaccacaaacccctcccagaatgaggactttaaaatggacgaaggg
accttcaagacaccagacattgatcttgcaaaggatgtttttgcagctcttggcactact
actcctgccagtgtggctagtgggcaagctcgtgagcttgcttcttccactgcagacagc
tctgtacctgctgcacctgcaaagaccgagaaaaccccagtagaagacaaatctgaagtg
caagcaacggaaactaagacacctccagcagaagtgaagacggtccccaacgaagccaca
caaacaaatgagaatgagagcaaagcatga

DBGET integrated database retrieval system