KEGG   Gallus gallus (chicken): 428264Help
Entry
428264            CDS       T01006                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10 precursor
  KO
K05443  interleukin 10
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04068  FoxO signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    428264 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    428264 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    428264 (IL10)
   04672 Intestinal immune network for IgA production
    428264 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    428264 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    428264 (IL10)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Interleukins
   428264 (IL10)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Cytokines
   428264 (IL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL10 IL22 MU117
Motif
Other DBs
NCBI-GeneID: 428264
NCBI-ProteinID: NP_001004414
CGNC: 588
Ensembl: ENSGALG00000000892
UniProt: Q6A2H4 B6RCP7
Position
26
AA seq 175 aa AA seqDB search
MQTCCQALLLLLAACTLPAHCLEPTCLHFSELLPARLRELRVKFEEIKDYFQSRDDELNI
QLLSSELLDEFKGTFGCQSVSEMLRFYTDEVLPRAMQTSTSHQQSMGDLGNMLLGLKATM
RRCHRFFTCEKRSKAIKQIKETFEKMDENGIYKAMGEFDIFINYIEEYLLMRRRK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctgctgccaagccctgttgctgctgctggctgcatgcaccctgcctgcccac
tgcttggagcccacctgcctgcacttctctgagctgctgcccgcccggctgcgggagctg
agggtgaagtttgaggaaattaaggactattttcaatccagggacgatgaacttaacatc
caactgctcagctctgaactgctggatgagtttaaggggacctttggctgccagtctgtg
tcagagatgctgcgcttctacacagatgaggtcctgccccgtgccatgcagaccagcacc
agtcatcagcagagcatgggcgacctgggcaacatgctgctgggcctgaaggcgacgatg
cggcgctgtcaccgcttcttcacctgcgagaagaggagcaaagccatcaagcagatcaag
gagacgttcgagaagatggatgagaacgggatctacaaagccatgggggagttcgacatc
ttcatcaactacatcgaggagtacctgctgatgaggaggaggaagtga

DBGET integrated database retrieval system