KEGG   Gallus gallus (chicken): 428275
Entry
428275            CDS       T01006                                 

Gene name
SMARCD2
Definition
(RefSeq) SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
  KO
K11650  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    428275 (SMARCD2)
   03036 Chromosome and associated proteins [BR:gga03036]
    428275 (SMARCD2)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     428275 (SMARCD2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    428275 (SMARCD2)
   PBAF complex
    428275 (SMARCD2)
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 428275
NCBI-ProteinID: XP_015154892
CGNC: 209
Ensembl: ENSGALG00000029304
Position
27
AA seq 503 aa
MAARGAFPLSPLPPSAAAAPPPPGPGPGMMRGPSPAPASAAAPGYRPMGPSGAQYQRPGM
PPGSRMPMAGLQVGPPGAPPYGAASPLRPGLPQSMMDPFRKRLLAPQSQPPMATQRRGVK
RRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRI
YISNTFTPAKEEGEGGERVASWELRVEGKLLEDPSKQKRKFSSFFKSLVIELDKELYGPD
NHLVEWHRLPTTQETDGFQVKRPGDVNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTR
ASIMQALWLYIKHNKLQDSHEKEYINCNRYFRQIFNCVRMRFSEIPMKLAGLLQHPDPII
INHTISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDAKIHETIESIN
QLKTQRDFMLSFSNNPQDFIQEWIKSQRRDLKIITDVIGNPEEERRAEFYQQPWAQEAVG
RHIFAKVQQRRQELEQVLGIRLT
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggccgcccgcggcgcgttcccgctcagccctctgcctccttccgccgccgccgctcct
ccgcctccgggacccgggcccggtatgatgagaggccccagcccggctccggcctccgcg
gccgccccgggataccgcccgatggggccttcgggagcgcagtaccagcgtcctgggatg
cctccaggcagccgcatgcccatggcagggctgcaggtgggacctccaggagcaccccca
tatggagcagcatcccctctgcgacccggcctgccccagtccatgatggaccccttcagg
aagcgcctgctggctccccagtcacagccacccatggccacccagaggagaggggtgaaa
aggaggaagatggctgacaaggtcctgccacagaggatccgggaacttgtcccagaatcc
caggcctacatggacctcctcgccttcgagcgcaagctggaccaaaccatcgctcggaag
aggatggagattcaggaggccatcaagaaaccactgacgcaaaagcggaagctgaggatt
tacatctccaacactttcaccccggccaaagaagaaggagagggtggtgagcgtgtggcc
tcttgggagctacgcgtggagggcaaactgctggaggacccaagcaagcagaagaggaag
ttctcctcctttttcaagagcctcgtcatcgagctggacaaagagctgtatgggccagac
aaccatctggtggagtggcaccgtctacccacgacccaggagactgatggcttccaagtg
aagcgtcctggcgatgtcaatgtgaagtgcaccctgctgctgatgctggatcaccagcca
ccacaatacaaactggaccctcgcctggctcgcctgctgggggtgcacacccagacccgt
gccagcatcatgcaggcgctctggctttacatcaagcacaacaagctgcaggacagtcat
gagaaggagtacatcaactgcaaccgctacttccgccagatcttcaactgtgtccgtatg
cgcttctctgagatccccatgaagttagcggggctcctgcagcacccagatcccatcatc
atcaaccacaccatcagcgtggaccccaatgaccagaagaagacggcctgctacgacatt
gacgtggaggtggatgaccccctgaaagctcagatgagcaacttcctggcttccaccacc
aaccagcaggagatcgcctccctggatgccaagatccacgagaccatcgaatccatcaac
cagctgaagacacagcgcgatttcatgctgagcttcagcaacaacccgcaggatttcatc
caggagtggatcaaatcgcagaggagggacctcaagatcataacagatgtgatcgggaac
cctgaggaggagcggcgagctgagttctaccaacagccctgggcacaggaggctgtgggc
agacacatcttcgccaaggtccagcagcgtcggcaggaactggaacaagtgcttgggatc
cgcctcacttaa

DBGET integrated database retrieval system