KEGG   Gallus gallus (chicken): 428309
Entry
428309            CDS       T01006                                 

Gene name
CNTNAP1
Definition
(RefSeq) contactin-associated protein 1
  KO
K07379  contactin associated protein 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    428309 (CNTNAP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    428309 (CNTNAP1)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   428309 (CNTNAP1)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C EGF Laminin_G_3 Fibrinogen_C
Other DBs
NCBI-GeneID: 428309
NCBI-ProteinID: XP_015155124
CGNC: 53330
Ensembl: ENSGALG00000003123
UniProt: F1NAE5
Position
27
AA seq 1306 aa
MGVRRLLGLLLAACAALLGPGPGPGCLARPCYDELVGSLYSSSIGASSRYNIFYSSSFAR
LHSTSGWSPDPRDKQPWLQIDLMQKHRINAVATQGTFNTYDWLTRYIVLYGDHPTSWKPF
FQQGSNWTFFGNVNESGVVRHDLHYPILARYVRIIPVAWNPRGKIGLRLGLYGCPYRSHV
LYFDGDDAISYRFRAKKISTMEDDISFNFKTVEQDGVLMHGEGSQGDYITVELKQAQLLL
HISLGSSPLHATEGHTTVAVGSLLDDQHWHSLHIERYGHHVNLTLDGEVKRFRCHGTFDH
LDLETEIFFGGVIDQDKQHLTYRQNFRGCVENIIFNGVNIADLARHRRSNIRFEGSVGHY
CQDQVNTPITFAGINNYVQVPGIPRRNRLAVSFRFRSWDTAGLLLYTSFADRLGSLEMVL
SEGQVNVSIAQPGKKKLEFAAGHRLNDGFWHSVQLVAREGSAVVTIDDDDGAEFRVAHPF
QLRTGSQYFFGGCPKPASLTGCRSNQTAFHGCLQMLSVDMQPVDLEMLVQHRLGKYADVF
FNVCGITDRCTPNLCEHDSRCVQSWDDFMCICDLTGYKGETCHKSLYKESCDAYRVSGKT
SGNYTIDPDGSGPLKPFTVYCDIREDRAWTIIRHNRHYATRVTGSSVDQPYLGEVEYWNA
SWAEVSALANASEYCEQRIEFHCYSSRLLNTPSGLPYSFWMGRNNERHYYWGGSRPGIQR
CACGLEKNCADPEYFCNCDANHALWRTDKGLLTFVDHLPVTQVVVGDTNRSGSEAQFLLG
PLRCYGDRNTWNTVSFNRGAALLFPTFRANHSLDISFYFKTTAPSGVFLENPGTQNYIRV
ELNTTRDVVFAYDIGNGHENLTVRSAVPWNDDEWHQVKAELNVKLARLRVDRLPWVVRPA
PPQSFVRLEFDRPLYVGSAEHKMRPFLGCLRALRMNGVTLNLEGKANETEGVQVNCTGHC
QDPPVPCQNSGLCVERYSHYSCNCSISAFDGPFCNYDIGGYFEEGAWVRYNILPMSLYAA
REFASIVSSPWQPLPGYNLTNEEVSFSFSTTSAPAVLLYVSSFVKDYMAVLIKDDGSLQL
RYQLGTSPYVFALTTKPVTDGRPHHVNITRWHRTLYTQVDYLPVMEQQFSLFVDSKLDSP
KNLYLGRVMETGVIDPEIQRYNTPGFSGCLSGVKFNSIVPLKAIFRPTSVVRPYSVQGEV
VESSCASMLPLTTILIPPEMDPWYMGTEFPHVHDDGWVGIIIGFVTFLLLLLGGLLVLLY
FYYHRYKGSYHTNEPKAIQDYSSAVKPLSVRKDQNLPQILEEPKGD
NT seq 3921 nt   +upstreamnt  +downstreamnt
atgggcgttcgccgtctcctcgggctcctgctcgccgcttgcgccgctctcctcgggccc
ggccccggccccggctgcctcgcacggccgtgttacgatgagttggttggatccctctac
tcctcgtccatcggcgcctcttcccgatacaacatcttctactcgtcaagcttcgcccgg
ctgcacagcaccagcgggtggtcccccgacccccgtgacaagcagccctggctgcaaatc
gacctgatgcagaagcacaggatcaacgcagtggccacgcaggggaccttcaacacatac
gactggctgacgcgctacatcgtgctctacggggaccaccccaccagctggaagcccttc
ttccagcagggcagcaactggactttctttgggaatgtgaatgagagtggggtggtgcgg
catgacctgcactaccccatcctcgcccgctacgtccgcatcatcccagtggcctggaac
ccacgagggaagatcgggttgcgcctgggcctctatggctgcccctaccgatcccatgtg
ctctacttcgatggagatgatgcaatctcctaccgcttccgggccaagaagatcagcacc
atggaagatgatatctccttcaacttcaagacggtggagcaggatggtgtgctgatgcat
ggggagggctcgcagggcgactacatcacggtggagctcaagcaagcccagctcctcctg
cacatcagcttaggcagcagtccgcttcatgccaccgagggccacacgacagtggcggtg
ggcagcctcctggatgaccagcactggcactcactgcacatcgagcgctacggccaccac
gtcaacctgacactggatggcgaagtgaagcgcttccgctgccatggcacctttgaccac
ctcgaccttgaaactgagatcttctttggaggggtgatcgaccaggacaagcagcacctc
acctaccggcaaaacttccgtggctgtgtggagaacatcatcttcaatggggtcaacatc
gctgacctggcccggcaccggagatccaacatccgctttgagggcagcgtgggccactac
tgccaggaccaggtgaacacccctatcacctttgctggcatcaacaactacgtgcaggtg
ccaggcatcccccgcaggaaccgtctggctgtcagctttcgcttccgctcctgggataca
gccgggctgctgctctacactagctttgctgaccgcctgggctcactggagatggtgctg
agcgagggccaggtcaatgtctccattgcccagcccggcaagaagaagctggagtttgct
gcaggacatcgcctgaacgatggcttctggcactcggtgcagctggtggcacgggagggc
tcagccgtggttaccattgatgatgacgacggtgctgagtttcgggtggctcatcccttc
cagctccgcaccggcagccagtacttttttggaggctgccccaagcccgcgtcgctcact
ggctgccgctccaaccagacggcgttccacggctgcctgcagatgctcagtgtggacatg
cagcccgtggacctggagatgctggtgcagcaccgcctggggaagtacgccgacgtcttc
tttaatgtctgtggcataacagacaggtgcacccccaacctctgcgagcatgacagccgc
tgcgtgcagtcctgggatgacttcatgtgcatctgcgacctgacgggctacaagggagag
acctgccacaaatccctttacaaagagtcctgtgatgcataccgggtcagcgggaagacc
tcggggaactacactattgacccagacggcagcggaccactgaagcccttcacagtgtac
tgtgacatccgagaggaccgggcatggaccatcatccggcacaatcggcactatgccacg
cgggtgacgggctccagcgtggaccagccctacctgggcgaagtggagtactggaatgcc
tcctgggccgaggtctcagcactggccaatgcctctgagtactgtgaacagcggattgag
ttccactgctacagctctcgcctgctcaacaccccctctgggctgccctacagcttctgg
atgggccgaaacaacgagcggcactactactggggcggctcgcggccgggcatccagcgc
tgcgcctgcgggctggaaaagaactgtgctgatcccgagtacttctgcaactgtgacgcc
aaccatgcactgtggaggacggacaagggtctgctgacctttgtggaccacctgcccgtc
acacaggtggtggtgggagacaccaaccgctccggatctgaagcacagttcctgctgggg
cctctccggtgctatggagaccgaaacacctggaacaccgtctccttcaacagaggtgca
gccctgctcttccccaccttccgagccaaccacagcctcgacatctccttctatttcaag
accaccgccccatccggcgtcttcctggagaaccccggcacacaaaactacatccgcgtg
gagcttaacaccaccagggatgtggtgtttgcctacgacatcgggaacgggcacgagaac
ctgacggttcgctcagcagtgccctggaatgatgacgagtggcaccaggtgaaggcggag
ctcaacgtgaagctggcccggctgcgggtggacagactgccctgggtggtgcggccggcc
ccgccacagagcttcgtccgcctggagttcgacagacccctctatgtcggctcggcagag
cacaagatgcgcccattcctggggtgtctgcgggcgctgcggatgaatggcgtgacgctc
aacctggagggcaaggccaacgagacagagggcgtgcaggtgaactgcaccggccactgc
caggacccgccggtgccctgccagaacagcgggctctgtgtcgagcgctacagccactac
agctgcaactgcagcatctctgcctttgatgggcccttctgcaactatgacatcggtgga
tacttcgaggagggtgcctgggtgcggtacaacatcctgcccatgtcgctgtatgctgcc
cgcgagtttgccagcatagtcagcagcccctggcagcccctgcccggctacaacctcacc
aatgaggaggtcagcttcagcttcagcaccacctcggcgcctgctgtgctgctctacgtc
agctccttcgtgaaggactacatggctgttctcatcaaggacgatgggagcctgcaactg
cgctaccagctgggcaccagcccctatgtctttgccctcaccaccaagccagtgacggat
gggagaccccaccacgtcaacatcacccgctggcaccgcacgctgtacacgcaggtggat
tatctgcctgtcatggagcagcagttctccctgtttgtggatagcaagttggactcaccc
aagaacctgtacctggggcgcgtgatggagactggtgtgattgaccccgagatccagcgc
tacaacacacccgggttctcaggctgcctctcgggggtgaagtttaacagcattgtcccc
ctcaaagccatcttccgccccaccagtgtggtgcggccctacagtgtgcagggggaggtg
gtggagtccagctgtgcctccatgctgcccctcaccaccatcctcatcccacccgagatg
gacccctggtacatgggcacagagttcccccacgtgcatgatgatggctgggtcgggatc
atcatcggattcgtgacattcttgctgctgctgcttgggggcttgctggtgctgctctac
ttctactaccaccgctacaagggctcctaccacaccaatgagcccaaggccatccaggac
tacagcagcgccgtcaaaccactgtcggtgcgcaaagaccagaacctgccgcagatcctg
gaggagccaaagggggactaa

DBGET integrated database retrieval system