KEGG   Gallus gallus (chicken): 428332Help
Entry
428332            CDS       T01006                                 

Gene name
SIRT6
Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-6
  KO
K11416  mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     428332 (SIRT6)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     428332 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 428332
NCBI-ProteinID: NP_001034409
CGNC: 850
Ensembl: ENSGALG00000001245
UniProt: Q5ZMR8
Position
28
AA seq 357 aa AA seqDB search
MAVNYAAGLSPYSDKGKCGLPEIFDPPEELERKVCELADLIRSSSNVVFHTGAGISTASG
IPDFRGPNGVWTMEEKGLSPKFDTTFENARPSKTHMALLGLQRVGILKFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECMKCGKQYVRDAVVGSMGLKPTGRLCSVTKARGLRACRGK
LRDTILDWEDSLPDRDLTLADEACRKADLSVTLGTSLQIKPSGNLPLITKKRGGKLVIVN
LQATKHDRQADLRIHAYVDDVMTKLLKHLGLEVPEWTGPVVVESADSAKPEQLYTFKPEA
HGLLKEEPFSQHNGTAGQCPDLGTTLVEHRDSLKQECPSPDTGPPLTKKMKVEPLLT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaattacgcggccgggctctcgccctactcggataagggcaagtgcggcctc
cccgagattttcgatccacctgaagagctggagaggaaggtgtgtgagctggcagacttg
ataaggagctcttccaatgtggtgttccatacaggggctggcatcagcaccgcctcgggg
attcctgacttcagggggcctaatggtgtctggactatggaagagaaggggctttccccc
aaatttgacaccacctttgagaacgccaggccctccaagactcacatggcacttctgggg
ctgcagagagttggcatcctgaaattcctggtcagccagaacgtggatggccttcatgtg
cgctcaggattcccacgggacaagttggctgagctccacgggaacatgtttgtggaggag
tgcatgaaatgtggcaagcagtacgtgcgggatgctgttgtgggcagcatggggttgaag
ccaacgggcaggctgtgcagcgtcaccaaagcacgagggctacgggcctgcagagggaag
ctaagagacactattctggactgggaagattccctgcctgaccgtgacctcacactagca
gatgaagcctgcaggaaagctgatctctctgttacactgggaacctctctgcagatcaaa
cccagtggcaacctcccactgatcacaaagaagagaggagggaagctggtcatagtcaac
ctacaagcaaccaagcacgacagacaggccgacctgcgcattcatgcttacgtcgatgat
gtcatgacaaaactgttgaagcacctggggctggaagtcccagagtggacagggccagtg
gtggtggaaagtgctgactctgccaagcctgaacagctctacacatttaagcccgaggct
cacgggttgctcaaggaggagcccttttcccagcacaatggaacagctgggcagtgcccc
gaccttgggaccacgctggtggagcaccgtgacagtctgaagcaggagtgtcccagtcca
gacacaggaccaccactgacaaagaagatgaaggtagagcctctcctcacctga

DBGET integrated database retrieval system