KEGG   Gallus gallus (chicken): 428340
Entry
428340            CDS       T01006                                 

Gene name
NRTN
Definition
(RefSeq) neurturin
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 428340
NCBI-ProteinID: NP_001074973
CGNC: 14663
Ensembl: ENSGALG00000021647
UniProt: A2PYM3
Position
28
AA seq 198 aa
MFNGSRTYSPLPSSPASRASSSSSSSSSLPVAPRRPPRALPRHSSLLAQYSSLLESYTEG
EIRQLISALVERYSQAMNSGGHELPLFPKAGNRMKRARARHKPCALKELEVSVSELGLGY
ESDETVLFRYCSGTCDAAVRNYDLSLKSVRSRKKIRKEKVRARPCCRPLAYDDDVSFLDA
YNRYYTVNELSAKECGCV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgttcaacggaagccggacatacagccccttgccttcctcgccagcctcacgggcatcc
tcctcctcctcctcctcttcctcgctgccggtggctccgcggagacccccccgggccctg
ccacgccacagctctctgctcgcccagtacagcagcctgctggagagctacacggaaggg
gagatccggcagctcatctcggcactagtggagcgttacagccaggccatgaactcgggc
ggccacgagctgcccctcttccccaaggcgggcaaccgcatgaagcgggcacgcgcccgc
cacaaaccctgcgccctgaaggagctggaggtgagcgtcagcgagttgggcctgggctac
gagtcggacgagaccgtgttgttccgctactgcagcggtacctgcgacgcggccgtcagg
aactacgacctctcgctgaagagcgtgcgcagccggaagaagatcaggaaggagaaggtg
cgcgcgcggccctgctgcaggccgctggcctacgatgatgacgtctccttcttggatgcc
tacaaccgctactacaccgtcaatgagctgtcggccaaagagtgcggctgtgtgtga

DBGET integrated database retrieval system