KEGG   Gallus gallus (chicken): 428365Help
Entry
428365            CDS       T01006                                 

Gene name
HEY1
Definition
(RefSeq) hairy/enhancer-of-split related with YRPW motif protein 1 isoform X2
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428365 (HEY1)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    428365 (HEY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Hairy_orange dCache_2 HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 428365
NCBI-ProteinID: XP_015138348
CGNC: 11739
Position
2
AA seq 344 aa AA seqDB search
MGETGAGRGAGRAPGALLPRALLPRAARRPLGGRPRAAAMKRAHPEYSSSDSEELDEAVE
VEKESADENGNLSSTAGSASPSATSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAF
EKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSI
IEGLDASDPLRVRLVSHLNNYASQREAASGAHAGIGHIPWGNAFGHHPHISHPLLLPQNG
PGNTSTTASSSEPHHQGRIAASHAETSSLRVPPNGSVGPVLPVVTSTTKLSPPLLSSMAS
LSAFPFSFGSFHLLSPNMLSPSAPTQSANLGKPYRPWGTEIGAF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggggagacgggcgcggggcgaggcgcggggcgcgcgccgggcgccctcctgccgcgc
gccctcctgccgcgcgccgcccgccgcccgctcggcggccgcccgcgcgccgccgccatg
aagcgggcgcaccccgagtacagctcgtcggacagcgaggagctggacgaggccgtggag
gtggagaaggagagcgcggacgagaacgggaacctgagctcgaccgcgggctccgcgtcg
ccgtccgccacctcgcagatcctggccaggaagcggcgccgagggatcatcgagaagcgc
cgccgcgaccgcatcaacaacagcctgtccgagctgcgccggctggtgcccagcgccttc
gagaagcagggatcggccaagctggagaaagccgagatcctgcagatgaccgtggatcac
ctgaagatgctgcacacggccggagggaaaggttatttcgatgctcatgctttggctatg
gactaccggagtctcgggttccgagagtgcctggctgaagtggctcgatacttgagcatt
atagagggcctggatgcctctgacccgctgcgggtccgactcgtgtctcacctcaataac
tacgcctctcagcgggaagcagcgagcggtgcgcatgccggcattggacacattccttgg
ggcaacgcctttggacatcaccctcacatatctcacccattgctgctgcctcaaaatggg
cccggcaataccagcaccacagcatcttcttcagaaccgcatcaccagggcagaatcgcc
gcctcacatgctgaaacttcctcactcagagtgcccccaaatggcagcgtcggaccagtg
ctccccgtggtcacatctactaccaaactgtctcctcctcttctctcctccatggcgtcg
ctgtctgcgttccccttttcgttcggctccttccatctactgtcccccaatatgctgagc
ccgtctgcaccaacacaatcagcaaaccttggcaaaccatacagaccgtgggggactgag
atcggagccttctaa

DBGET integrated database retrieval system