KEGG   Gallus gallus (chicken): 428401
Entry
428401            CDS       T01006                                 

Gene name
ALS2CL
Definition
(RefSeq) ALS2 C-terminal-like protein isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: VPS9 MORN Antimicrobial_6
Other DBs
NCBI-GeneID: 428401
NCBI-ProteinID: XP_004939151
CGNC: 4046
Ensembl: ENSGALG00000005430
Position
2
AA seq 998 aa
MSPCPISQGNASCESSSSKCRSCVRRETGRTGMEVQELGKQLWKCNDMCAAEATASLLQV
EENFSACLARMDALIFKPLLQSEPSDQKGKENFKLFLLLNDQFQALWNLTEENYRIVKQK
CSTSESFCIQDIYIVWKGDLFLSLYIQYFVTFANYVVVHGFEHATKSKSEAWKHHKTVLK
QFLTDFTTETSMSLALYTVLHKPIRDHVEQYILLLNKLNEVLQEGSEKDIVTSAVKEYVK
LKSFISQVLDEACFTKTLWKSLGYKFTDMLCVPERRLLEDSKNLPISASTNRSDRILLFD
DVLVLIQGNSFQSFDLKLVWVDETCREKSAPGPYGLRIITPEETFVLSAKDPQMKAVWQW
KLNQAIRQALNGKRDFPLWGKTGEGTEPSSCRFFTYVFRLESKFKNASYEGEWHWGKPHG
KGTLKWRDGRNHVGDFKEGLEHGFGICLVPRRSEDRYDCYKCHWYEGKMRGYGICEYGND
MVYKGYFKDDVRQGFGILENFSAEHPFKYTGQWENDKKNGYGVWEDKDRGERYIGTWLDD
HRHGQGIVVTQSGVCYQRTFHADKMVGSGILLLEDDSVYEGNFTQDLTFVGKGKLSFANG
FILEGTFTNKSGQGLQTQGILNTSNEQLDERITKAQLGLKEFPVEKRWKGIYDQFLEFIH
SGCKEEMEESFTGFHIQTSKELRKSQEYLFCQRGTEDVSWKTEDILEELVQHHELGSLQS
YLEKALKSSLHPLGKLLKALTIAFQATYSGIGANRHLLTMAQEEVKYYAKKIWEFYQGLL
HLALEQKGQLPAKCVDGEVSDQKAYSVVLPLILPCFYPELFMLYMLYHEREDDLYCQGIV
DLSLFPDIKLLEFLDVQKHLWPLKDLTLTTNQRRSLIKDKCFLSATECLQKLITTVDPRE
KLLILQKTYEEIESTVSRVVEKDYKLPMDDLLPLLMYVVSRAKIQHLGAEIHLIRDLMDP
TNQGGLYDFLLTALESCYEHIQRMRLHQRENCHVTRTS
NT seq 2997 nt   +upstreamnt  +downstreamnt
atgtccccatgccccatttcccagggaaatgcctcctgcgagagctcctccagcaagtgc
agaagttgcgtgaggagagagaccggcagaacagggatggaagtacaggagcttggcaaa
cagctatggaaatgcaacgacatgtgtgcagctgaagctactgcatctttgctccaagtg
gaagaaaacttttcagcatgcctggcacggatggatgccctcatcttcaagcctctgcta
cagtcagagcctagtgaccagaaaggaaaagagaactttaagctctttctgctcctgaat
gatcaatttcaagctctctggaacctcacagaagagaattaccggatagtgaagcaaaaa
tgcagcacttctgagtcattctgcattcaggatatttacattgtctggaaaggagacctg
ttcctcagcttgtacatccagtattttgtcacttttgccaactatgtcgtagtccatggc
ttcgaacatgccacgaagagcaaaagtgaagcctggaagcaccataagacagtgctgaaa
caattcctcacagacttcaccactgagacctccatgtcattggccttgtacaccgtcctt
cacaaacctatccgtgaccacgtcgagcaatatatactgctccttaacaaactgaatgag
gtcctccaagagggctctgaaaaggacattgttaccagcgctgtcaaggaatatgtgaag
ctgaagtctttcattagccaagttttggacgaagcttgttttaccaagaccttatggaaa
tccttgggctacaaattcacggacatgttgtgtgttcctgaaaggaggctgctggaagat
agcaaaaatctccccatctccgccagtacaaatcgatcagaccgaatcttgctctttgat
gatgtccttgtgctaattcagggaaacagctttcagagctttgatctgaagcttgtgtgg
gtagatgaaacctgcagggagaaatcagctccgggaccgtatggacttcgcattataacc
ccggaagaaacgtttgttctctctgccaaagacccacagatgaaggctgtttggcagtgg
aaactgaaccaagccatccgacaggctttgaatgggaagcgagatttccccctgtggggt
aaaactggagaaggcaccgagccctcatcctgccgcttcttcacttacgtcttcaggctg
gagagcaagttcaaaaacgcatcctatgagggtgaatggcactggggaaagcctcatggc
aaggggacactgaagtggcgtgatggtcgcaaccatgttggagatttcaaagagggcttg
gagcatgggtttggaatatgccttgtccctcgccgatctgaagaccggtatgactgctat
aagtgccactggtatgagggcaagatgagaggctatggaatctgtgagtatgggaatgat
atggtctacaaaggctacttcaaagacgatgtgcgtcaagggtttggtatactggagaac
ttctcagctgaacatccatttaaatacacaggacagtgggaaaatgacaagaagaatgga
tatggagtctgggaagacaaggacagaggggagagatacatagggacatggcttgatgat
cacagacatggacaaggcattgtggtcacccagtcaggtgtctgctatcaaaggacattt
catgctgataaaatggtgggttctgggattctgctcttggaagatgactcagtctatgaa
ggaaacttcacgcaagatctaacatttgtgggaaagggaaagctgtcatttgccaatggc
tttattctggagggaacctttactaataaatcaggccaaggccttcagacacaaggtatc
ctgaatacatcgaacgagcagctggatgagagaataaccaaagctcagctgggcctcaag
gagttcccggtagagaagaggtggaagggaatctatgaccagttcctggagttcatccat
tcgggttgcaaggaagaaatggaggagtcttttacgggatttcacatacaaacaagcaaa
gagctccggaaatctcaggagtacctcttctgccaaagggggactgaggatgtttcctgg
aagacagaagatattcttgaagagcttgtccagcaccatgaactggggtcactacagagc
tatttagagaaggcattgaaatcttctctgcacccactgggaaagctgctgaaggccttg
acaatagcttttcaggcaacttactccgggattggggccaacagacacttgctgactatg
gcacaagaggaagtcaagtactatgcaaagaaaatatgggagttttaccagggtttgctc
catctggcattggaacagaaaggtcaactgcctgcaaaatgtgtagatggagaggtaagc
gaccagaaggcatacagtgtggtccttccgttgatcttgccctgcttctaccctgagctt
ttcatgctctacatgctctatcatgaaagggaagatgacctctactgtcaagggattgtg
gacctaagtctatttcctgacatcaagctgctggagtttctggatgtacagaaacacctt
tggcctctgaaagacctcaccttgacaaccaaccagaggcggtccctgatcaaagacaag
tgtttcctgtctgccacagagtgtttgcagaagttgatcaccacagtggatccccgggaa
aagctgctgatcctccagaagacatatgaggagatagagagcactgtgtcccgagtggtg
gagaaagactacaagctccctatggatgacctcttgcccctcctgatgtatgttgtatca
cgagctaaaatacagcacctgggagctgaaatccatctgatcagagacttgatggacccc
accaatcaaggaggattgtatgactttctattaacagcactggagtcatgctatgaacac
atacagaggatgaggctccaccaaagagagaactgtcacgtgactcgcacctcctga

DBGET integrated database retrieval system