KEGG   Gallus gallus (chicken): 428412
Entry
428412            CDS       T01006                                 

Gene name
CCNY
Definition
(RefSeq) cyclin-Y isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Cyclin_N Cyclin
Other DBs
NCBI-GeneID: 428412
NCBI-ProteinID: XP_015137612
CGNC: 5343
Ensembl: ENSGALG00000007076
Position
2
AA seq 344 aa
MGNTTSCCVSSSPKLRRNAHSRLESYRPEADLSREDTGCNLQHISDRENIDDLNMEFNPS
DHPRASTIFLSKSQTDGKLLREKRKSLYINHHPPGQLRRKYSSCSTIFLDDSTVSQPNLK
YTIKCVALAIYYHIKNRDTDGRMLLDIFDENLHPLSKSEVPPDYDKHDPEQKQIYRFVRT
LFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDY
CQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRD
RAYKLEAISRLCEDKYKDFRKSAKKRSVSADNLTVVRWSPAIIS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggggaacaccacctcctgctgcgtctcgtccagccccaagctgcgccggaatgcccac
tcccggctggaatcctaccgccccgaggccgacctgagccgtgaggacacgggctgcaac
ctgcagcacatcagcgaccgggagaacatcgacgatttgaacatggaattcaacccatca
gaccatccacgggccagtacgatatttctcagtaaatctcaaacagatggaaaattattg
agagaaaaacgcaagagtctctatataaaccaccatcctcctggacagctgagaagaaag
tacagttcctgctccactattttcctggatgacagcacagtcagtcaacctaacctcaag
tataccatcaaatgtgtagctcttgcaatatattaccacatcaaaaacagggatacagac
ggaagaatgctcttagatatttttgatgaaaaccttcatcccctttcgaaatccgaagtg
ccaccagattatgacaaacacgacccagagcagaaacagatttaccgcttcgttcggaca
ttgttcagtgctgctcaactgactgctgaatgtgccattgtcacgctggtatatcttgaa
agacttctaacgtatgcagagatagatatttgtccagcaaactggaagcgaattgtactg
ggtgctattctgctggcatccaaggtttgggacgaccaagcagtgtggaatgtggattac
tgccagatcctgaaagatatcacagttgaagacatgaatgaactggaacgccagtttctg
gagctgttgcagttcaatattaatgttccctccagtgtttatgccaagtattattttgat
ttgcgttccttggcagaagcaaataacctgagttttcctttggagcccctcagcagggat
agggcatataaacttgaggccatttcccgcttgtgtgaagataaatacaaggacttcagg
aaatctgcaaagaaacggtcagtcagtgctgacaatctgactgtggttagatggtctcct
gctattatctcctaa

DBGET integrated database retrieval system