KEGG   Gallus gallus (chicken): 428429
Entry
428429            CDS       T01006                                 

Gene name
FERD3L
Definition
(RefSeq) fer3-like protein
  KO
K22400  Fer3-like protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428429 (FERD3L)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    428429 (FERD3L)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 428429
NCBI-ProteinID: XP_425989
CGNC: 8252
Ensembl: ENSGALG00000010862
Position
2
AA seq 183 aa
MSAGLFPAHRRPELLRGTAPPLPCPERLLGASVLGFVADISLGAPQSSSRAGPSLGLTSE
PPFGDRTLSLREGMARGLPLAAFGDGDLEDEEEEEEEERMRSASLLDRPRRKRVITYAQR
QAANIRERKRMFNLNEAFDQLRKKVPTFAYEKRLSRIETLRLAIVYISFMTELLNGCSRQ
EAS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtcagccggcctcttcccggcccaccggcgcccggagctgctccgcggcacagctccg
ccgctcccctgcccggagcggctgctgggtgcctcggtgctgggtttcgtggccgacatc
tcgctgggagccccccagagctcatctcgggccggaccgagcctggggttaacctccgag
cctcccttcggggacagaaccctgtcgctgcgggaggggatggcccgggggttgcctttg
gctgccttcggagacggggatctcgaagacgaggaagaagaggaagaagaggagagaatg
cggagcgcttccctactggacagacccaggagaaagcgggttatcacctacgcccagcgc
caggcagccaacatccgggagaggaagaggatgttcaacctcaacgaggcgttcgaccag
ctgaggaagaaggtgcccaccttcgcctacgagaagcggctctcccggatagagaccttg
cgcctggccatcgtgtacatctccttcatgaccgagctcctgaacggctgcagcaggcag
gaggcgagctag

DBGET integrated database retrieval system