KEGG   Gallus gallus (chicken): 428434
Entry
428434            CDS       T01006                                 

Gene name
EVX1
Definition
(RefSeq) homeobox even-skipped homolog protein 1
  KO
K09320  homeobox even-skipped homolog protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428434 (EVX1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Eve
    428434 (EVX1)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 428434
NCBI-ProteinID: XP_425994
CGNC: 8411
Ensembl: ENSGALG00000037310
Position
2
AA seq 409 aa
MESRKEMVMFLEGTQLGALVGKRVPNLTETVRSPAPEPQEKMIPRNCLSPRPGPLSSRER
GGGGGGGGGEDEEEVEVLPGTGTVPESRSAAAALLGAGQQPPGTEPPSSKGQQSSSDTES
DFYEEIEVSCTPDCATGSAEYQHSKGPCPEARAGSPGGGGDHPKGGGGGGGGGGGSQGPL
SCSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRR
MKDKRQRLAMTWPHPADPAFYTYMMSHAAATGNLPYPFPSHLPLPYYSHMGIGATSASAA
APFSTPLRPLDTFRVLSHPYPRPELLCAFRHPSLYPAPSHGLGSAGGSPCSCLACHGSPS
NGLAQRPAGSDFTCSATTRTDSFLTFTPSVLSKATSVSIDQREEVPLTR
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggaaagcaggaaggagatggtgatgtttctggaagggacgcaactcggcgctctggtt
ggcaagagggtgcctaatttgaccgaaacggtgaggagccccgctccggagccgcaggag
aagatgatccctcggaactgcctcagccccagacctggccccttgtcgtcccgggagaga
ggaggaggaggaggaggtggcggaggagaagacgaagaggaggtggaggtgctgccgggg
acagggacggtgccggagagccgctcggcggcggcggcgctgctcggggccggacagcag
ccccccggcacggagcccccctccagcaaagggcagcagagcagctcggacaccgagtcg
gatttctatgaggaaatcgaggtgagctgcaccccggactgcgccacggggagcgccgag
taccagcacagcaaagggccgtgccccgaggctcgagccggcagccccggcggcggcggg
gatcaccccaagggcggcggcggcggcggcggcggcggcggcggctcccagggcccgctg
agctgcagcgccagcgatcagatgcgccggtaccgcaccgccttcacccgcgagcagatc
gcccggttggagaaggagttttaccgggagaactacgtgtccaggccccggagatgtgaa
ctggctgctgctctaaatctgccagaaaccaccatcaaggtgtggttccagaaccggcgg
atgaaggacaagcggcagcgcctggccatgacctggccgcacccggcggacccggcgttc
tacacctacatgatgagccacgcggccgccaccggcaaccttccctaccccttcccatcc
cacctgcccctgccctactactcccacatgggcatcggggccacctcggcctcggccgcc
gctcccttcagcaccccgctgcggccgctggacaccttccgcgtcctgtcccacccgtac
ccgcggccggagctgctctgcgccttcaggcacccctctctgtaccccgccccgagccac
ggactcggcagcgccggtggcagcccctgctcgtgcctggcgtgccacggcagcccgtcc
aacgggctggcacagagacccgccgggtcagactttacctgctcggccaccaccaggacg
gactccttcctcactttcaccccctcggtgctgagcaaagccacctcggtttccattgac
cagcgggaagaagtacctttaacgagataa

DBGET integrated database retrieval system