KEGG   Gallus gallus (chicken): 428435
Entry
428435            CDS       T01006                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X3
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    428435 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428435 (CREB5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    428435 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri Cnn_1N NDUFB11 DivIC
Other DBs
NCBI-GeneID: 428435
NCBI-ProteinID: XP_004939439
CGNC: 8458
Ensembl: ENSGALG00000038265
UniProt: A0A3Q2UBL5
Position
2
AA seq 369 aa
MFCTSAGNSGSVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPME
RQMSMNSNIMGMQGPNLNNPCASPQVPPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMM
EMMSSRQDQTPHHHMHSHPHQHQTLPPHHSYPHQHQHPAHHPHPQPHHQQNHPHHHSHSH
LHAHPAHHQTSPHPPLHSGGQAQVSPAAQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRR
KFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHK
DCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSDVVGSSTLTQLAS
HRTDINPIL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttctgcacctcagcagggaattcaggctcagtgatgtccatgaggcctgtcccaggt
tctctgtcttcgctattgcatctacacaacagacaaagacagcctatgccagcctctatg
cctggcaccctgcccaaccctaccatgcctggatcttctgctgtactcatgcctatggag
cgacaaatgtcaatgaactccaacatcatgggaatgcaggggccaaacctcaacaaccct
tgtgcttcacctcaagtccccccaatgcattcggaagccaaaatgagattgaaggcagca
ctgactcatcaccctgccgccatgtcgaacgggaatatgaacaccatgggccacatgatg
gaaatgatgagctcgcggcaggaccagacgccacaccatcatatgcactcacatcctcat
caacaccagacactgccacctcaccactcctacccccaccagcaccagcacccagcgcac
catcctcatcctcagcctcatcaccagcagaatcacccccaccaccactcccactcgcac
cttcacgcacacccggcacatcaccagacctcgccgcacccaccgctgcattcgggcgga
caagcacaggtttcaccggccgcacagcaaatgcagcccacgcagacgatacagccgccg
cagcctactggaggccgccggagaagggtggtggatgaagaccctgatgagaggaggagg
aaatttctggagaggaaccgagccgctgccacacgctgcagacagaagaggaaggtctgg
gtgatgtcactggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaat
gaggtctccatgctgaaaaatgaggtagcacagctgaaacagttgttgttaacgcataaa
gactgtccgataacagccatgcagaaagaatcacaaggatatctaagtcctgagagcagt
cctcctgcgagcccggtcccagcatgctcccagcagcaagtcatccagcacaacaccatc
accacctcctcctccgtcagcgatgttgtgggcagctccactctcacccagctcgccagc
cacagaacagacatcaaccccatcctttaa

DBGET integrated database retrieval system