KEGG   Gallus gallus (chicken): 428534
Entry
428534            CDS       T01006                                 

Gene name
SOX17
Definition
(RefSeq) transcription factor SOX-17
  KO
K04495  transcription factor SOX17 (SOX group F)
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    428534 (SOX17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428534 (SOX17)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    428534 (SOX17)
SSDB
Motif
Pfam: HMG_box Sox17_18_mid HMG_box_2 HTH_24
Other DBs
NCBI-GeneID: 428534
NCBI-ProteinID: NP_001034415
CGNC: 53393
UniProt: Q4LES8
Position
2
AA seq 410 aa
MSSPDAGYASSEEQAQGRGALPAMMPALGPCPWAEALSPPGEAKAKGEAGATGGRGKGEA
RIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALSLAEKRPFVEEAERLRV
QHMQDHPNYKYRPRRRKQVKRLKRAEGGFAQHGPAEAAPPALGPDGGGVGTCGESLALPY
AERGYAAGPGRYRDCPPLGAAFDGFGLPTPDPSPLDAAHGEAPFFAPGPPDECAPGPYGG
YGPAAAGDFAAAGAGESPAGAALRRHQHQHHQPHQHSHPAAGELGPGGALPGLLGCPAPP
HYYGQLCPGRGPPAPVPVPVAVALGAQPSPPPEAAACREPLEHLPQEELLGEVDRSEFEQ
YLRFACKAELGPPFAGHDVAGLASPEAAGPLSAVVSDASSAVYYCGYADG
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgagcagccccgatgcgggctacgccagcagcgaggagcaggcgcagggccggggcgcg
ctgcccgctatgatgccggccctgggcccgtgcccctgggcggaggcgctgagcccgccg
ggcgaggccaaggcgaagggcgaggcgggggcgacgggcgggcgcggcaagggcgaggcg
cggatccggcggcccatgaacgccttcatggtgtgggcgaaggacgagcgcaagcggctg
gcgcagcagaacccggacctgcacaacgcggagctcagcaagatgctgggtaaatcgtgg
aaggcgctgtcgctggcggagaagcggccgttcgtggaggaggcggagcggctgcgggtg
cagcacatgcaggaccacccgaactacaagtaccggccgcggcggcggaagcaggtgaag
cgcctgaagcgggcggagggcggcttcgcgcagcacggcccggccgaggcggcgccgccc
gcgctgggccccgacggaggcggcgtcgggacgtgcggcgagagcctggcgctgccgtac
gcggagcgcggctacgcggcggggccggggcgctaccgggactgcccgccgctgggcgcc
gccttcgacggcttcgggctgcccacgccggacccgtccccgctggacgcggcgcacggc
gaggcgcccttcttcgcgccggggccgcccgacgagtgcgcgccggggccctacggcggc
tacggccccgcggcggcgggagacttcgcggcggcgggagcgggcgagagccccgcgggg
gcggcgctgcggcggcaccagcaccagcaccaccagccgcaccagcactcgcaccccgct
gccggcgagctggggccgggcggcgccctgccggggctgctgggctgcccggcgccgccg
cactactacgggcagctgtgcccgggccgcggcccgcccgctcccgtgcccgtgccggtg
gctgtggcgctgggcgcgcagccgtccccgccgcccgaggccgcggcgtgccgggagccg
ctggagcacttgccgcaggaggagctgctgggcgaggtggaccgcagcgagttcgagcag
tacctgcgcttcgcctgcaaggccgagctggggccgcccttcgcgggccacgacgtggcc
gggctggcgtcgcccgaggctgcggggccgctctccgccgtggtgtcggacgccagcagc
gccgtctactactgcggctacgccgacggctga

DBGET integrated database retrieval system