KEGG   Gallus gallus (chicken): 428549Help
Entry
428549            CDS       T01006                                 

Gene name
NKX2-2
Definition
(RefSeq) homeobox protein Nkx-2.2
  KO
K08029  homeobox protein Nkx-2.2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428549 (NKX2-2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    428549 (NKX2-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 428549
NCBI-ProteinID: NP_001264647
CGNC: 25123
Ensembl: ENSGALG00000036869
UniProt: A0A1D5PPK4
Position
3
AA seq 272 aa AA seqDB search
MSLTNTKTGFSVKDILDLPDTNDEDGSAAEGGEEESEAPEPPKKAAVLGQTPLDAVQTLP
LKPPFYDNSDNPYTRWLASAEGIQYSLHGLAAGAGGPEAGSKSPEPSADESPDNEKEAAG
GGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRY
KMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHTLKAQDLAAATFQTGIPFSAYSAQS
LQHMQYNAQYSAAGSPQYPTAHHLVQAQQWTW
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaccaacacaaagacgggtttttccgtcaaggacatcctggacctccccgac
accaacgacgaggacggctccgccgcggaagggggagaggaggagagcgaagcgccggag
cctcccaagaaagcggcggtgttgggccaaacccccttggacgctgttcagacgctgcct
ttgaagccccctttctatgataatagcgataatccctacacgcgctggctggcgagcgcc
gagggcatccagtactccctgcacggactggcggccggagcaggcggcccggaggccggc
tccaagtccccggagccgtcggccgacgaatcgcccgacaacgagaaggaggcggcgggc
ggaggggacgcggggaagaagaggaagaggagggtgctcttctccaaggcgcagacctac
gagctggagcggcggttccggcagcagcggtacctgtcggcgccggagagggagcacctg
gccagcctgatccgcctgacgcccacccaggtgaagatctggttccagaaccaccgctac
aagatgaagcgggcccgggccgagaaaggtatggaagtgactcctctcccctccccgcgg
cgggtggccgtgccggtcctggtgcgggacggcaagccctgccacacgctcaaagctcag
gacttggcggccgccaccttccagacgggcatccccttctccgcctatagcgcccagtcc
ctccagcatatgcaatacaacgcccagtacagcgcggccggcagcccccagtaccccaca
gcgcaccacttggtacaggcgcagcaatggacttggtga

DBGET integrated database retrieval system