KEGG   Gallus gallus (chicken): 428577
Entry
428577            CDS       T01006                                 

Gene name
CDC42EP3
Definition
(RefSeq) cdc42 effector protein 3
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: BORG_CEP PBD CEP76-C2
Other DBs
NCBI-GeneID: 428577
NCBI-ProteinID: XP_015139239
CGNC: 8012
Ensembl: ENSGALG00000010551
UniProt: E1C7B1
Position
3
AA seq 253 aa
MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQ
GNYELLPGNEGETRVSQSGGHSEFLRANSTSESMFTETPSPVLKNAISLPAIGGSQALML
PLLSPVTFNSKQESIRSSRNPRVSCEPVIEEKLQEKSKQTENGETYKDDVWEQNGSSSHF
INGRDSNSSSFSERCTDWQTVDLFEDSRLSCELTKTKSEESLSDLAGSLLSLQLDLGPSL
LDEVLNVMDKNKS
NT seq 762 nt   +upstreamnt  +downstreamnt
atgccagccaagacacctatctacttgaaagccgctaacaataagaaagggaagaaattc
aaactaagggatatcttgtctcctgatatgatcagtccaccacttggagattttcgtcac
accatacatattggaaaagagggacaacatgatgtttttggggacatctcctttttgcag
ggaaactatgaattattgcctggaaatgaaggagaaactagagttagccaatctggtggc
cacagtgaattcttaagggcaaacagcacttcggaatccatgtttacagaaactccatcc
ccagtgctcaaaaatgctatttcccttcctgccattgggggttctcaagccctcatgttg
cccttattgtcaccagtgacgtttaattcaaagcaagaatccatcaggtcatcaagaaac
ccacgggttagctgtgagccagtaattgaagaaaagttgcaggagaaaagtaaacagacg
gagaacggagaaacatacaaagatgacgtatgggagcaaaatggttcttcatcgcatttt
attaatggtagagacagtaactcatccagcttttctgaacgatgcactgattggcaaaca
gttgatttgtttgaagatagccgactttcgtgtgaactaaccaagacaaagtcagaagaa
tccctttcagatcttgcaggctctcttctctcattacaacttgacttgggaccttcactt
ttggatgaggtcctcaatgtaatggacaagaataaatcttag

DBGET integrated database retrieval system