KEGG   Gallus gallus (chicken): 428612Help
Entry
428612            CDS       T01006                                 

Gene name
OLIG2
Definition
(RefSeq) oligodendrocyte transcription factor 2
  KO
K09085  class B basic helix-loop-helix protein 1/6/7
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428612 (OLIG2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    428612 (OLIG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH UBN_AB CCDC106
Motif
Other DBs
NCBI-GeneID: 428612
NCBI-ProteinID: NP_001026697
CGNC: 10371
Ensembl: ENSGALG00000031010
UniProt: Q90XB3
Position
1
AA seq 298 aa AA seqDB search
MDSDASLVSSRPSSPEPDELFLAGRNKGGGGGGGGGGGFTGGTVSSSTQSDSPPELSAEL
RSAMSAAGVVVVDKLGFKSSSSSASSASSASSKKDKKQMTEPELQQLRLKINSRERKRMH
DLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHA
AFHPAACPAGMGAHSAPLPAHPGHPASHPAHHPILPPAAVSSASLPGSGLSAVGSIRPPH
GLLKSPSAAAAAPGLGGGFQHWGGMPCPCSMCQVAAPPHHHVSAMGGAALPRLASDAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggactcggacgccagcctggtctccagccgcccgtcctccccggagcccgatgagctc
ttcctcgcgggccggaataaaggcggcggcggaggaggaggaggcggcgggggcttcacg
ggcggcaccgtgtccagctcgacgcagagcgattcgccgccggagctgagcgccgagctg
cgcagcgccatgagcgccgcgggggtggtggtggtggacaagctgggcttcaagtcctcg
tcgtcgtcggcctcgtcggcctcgtccgcctcctccaagaaggacaagaagcagatgacg
gagccggagctgcagcagctgcgcctgaagatcaacagccgcgagcgcaagcggatgcac
gacctcaacatcgccatggacgggctgcgggaggtgatgccctacgcgcacggcccgtcg
gtgcgcaagctctccaagatcgccacgctgctgctggccagaaactacatcctgatgctc
accaactcgctggaggagatgaagcgcctggtcagcgagatctacggcggccaccacgcc
gccttccaccccgcagcctgtcccgccggcatgggcgcgcactcggcgccgctgcccgcc
cacccgggccaccccgcctcgcaccccgcgcaccaccccatcctgccccccgccgccgtc
tccagcgcctccctgcccggctccggcctctcggccgtcggctccatccgccccccgcac
ggcctcctcaagtcgccctcggccgccgccgccgctccggggctggggggcggcttccag
cactggggggggatgccgtgcccctgcagcatgtgccaggtggcggccccccctcaccac
cacgtctcggccatgggcggcgccgcgctgccgcgcttggcctccgacgccaagtga

DBGET integrated database retrieval system